PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIDC4AG030480.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 53aa MW: 5610.49 Da PI: 6.4465 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 41.9 | 1.5e-13 | 3 | 46 | 331 | 374 |
GRAS 331 ekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374 +aa+qa+lll +++sdgy++ ee+g+l lgWkd L+++SaWr TRIDC4AG030480.1 3 GSAAAQASLLLGMFPSDGYTLVEENGTLKLGWKDLCLLTASAWR 46 5799***************************************8 PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 53 aa Download sequence |
LAGSAAAQAS LLLGMFPSDG YTLVEENGTL KLGWKDLCLL TASAWRPFQA LGR |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54220.1 | 1e-16 | GRAS family protein |
Link Out ? help Back to Top | |
---|---|
Ensembl | TRIDC4AG030480.1 |