PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIDC3AG068630.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 40aa MW: 4612.23 Da PI: 8.821 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 35.6 | 1.3e-11 | 5 | 35 | 344 | 374 |
GRAS 344 vksdgyrveeesgslvlgWkdrpLvsvSaWr 374 + dg++v ee+g+++l+W+dr+L+svSaWr TRIDC3AG068630.3 5 LGCDGFKVREEKGTFFLCWQDRALFSVSAWR 35 5679**************************8 PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 40 aa Download sequence |
AAQGLGCDGF KVREEKGTFF LCWQDRALFS VSAWRGRRFD |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G50420.1 | 4e-13 | GRAS family protein |
Link Out ? help Back to Top | |
---|---|
Ensembl | TRIDC3AG068630.3 |