PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zmw_sc04056.1.g00050.1

Organism

Zoysia matrella

Taxonomic ID

38722

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia

Family

MYB

Protein Properties

Length: 294aa MW: 31604.4 Da PI: 10.143

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zmw_sc04056.1.g00050.1	genome	ZGD	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	59.8	6e-19	11	56	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEde l ++v+++G ++W++I r ++ gR++k+c++rw + Zmw_sc04056.1.g00050.1.sm.mk 11 KGPWSPEEDEALRRLVERHGARNWTAIGRGIP-GRSGKSCRLRWCNQ 56 79****************************.*********985 PP
2	Myb_DNA-binding	53.4	5.9e-17	63	106	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r ++T+eEd +++a+++ G++ W++Iar ++ gRt++ +k++w++ Zmw_sc04056.1.g00050.1.sm.mk 63 RRPFTPEEDATILRAHAEIGNR-WAAIARLLP-GRTDNAVKNHWNS 106 679*****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.481	6	61	IPR017930	Myb domain
SuperFamily	SSF46689	5.62E-32	8	104	IPR009057	Homeodomain-like
SMART	SM00717	9.6E-17	10	59	IPR001005	SANT/Myb domain
Pfam	PF00249	3.7E-18	11	56	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.2E-25	12	64	IPR009057	Homeodomain-like
CDD	cd00167	3.41E-16	13	55	No hit	No description
SMART	SM00717	1.6E-15	62	110	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	20.976	63	112	IPR017930	Myb domain
Pfam	PF00249	3.0E-15	63	106	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.6E-24	65	112	IPR009057	Homeodomain-like
CDD	cd00167	3.30E-12	65	108	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009414	Biological Process	response to water deprivation
GO:0009651	Biological Process	response to salt stress
GO:0009723	Biological Process	response to ethylene
GO:0009733	Biological Process	response to auxin
GO:0009737	Biological Process	response to abscisic acid
GO:0009739	Biological Process	response to gibberellin
GO:0010200	Biological Process	response to chitin
GO:0042742	Biological Process	defense response to bacterium
GO:0046686	Biological Process	response to cadmium ion
GO:0050832	Biological Process	defense response to fungus
GO:2000022	Biological Process	regulation of jasmonic acid mediated signaling pathway
GO:2000031	Biological Process	regulation of salicylic acid mediated signaling pathway
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 294 aa Download sequence Send to blast
MGAEAECDRI KGPWSPEEDE ALRRLVERHG ARNWTAIGRG IPGRSGKSCR LRWCNQLSPQ 60 VERRPFTPEE DATILRAHAE IGNRWAAIAR LLPGRTDNAV KNHWNSSLKR KVVATATTEA 120 AAERPCKRVS PAPGSPTGSD RSELSHGSVG CGGAQVYRPV PRPGGFDTIR SANVRPAPSA 180 PTSGRDEDPL TSLSLSLPGQ DQQGSSGFRH DSARSHFQEL SPSRSPSPQP SHYPFSGELV 240 AAMQDMIRAE VRKYMSGVGL RAGCGPGAAG EKSIVEGVMR AAAERVGVVT SRQF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	6e-41	8	112	4	108	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202, ECO:0000269\|PubMed:23603962, ECO:0000269\|PubMed:24894996, ECO:0000269\|PubMed:9678577}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00653	PBM	Transfer from LOC_Os02g09480	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001147631.1	1e-147	uncharacterized protein LOC100281240
Swissprot	Q9FDW1	9e-72	MYB44_ARATH; Transcription factor MYB44
TrEMBL	A0A3L6RS06	1e-149	A0A3L6RS06_PANMI; Uncharacterized protein
STRING	GRMZM2G145444_P01	1e-146	(Zea mays)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP789	38	154

Publications ? help Back to Top
Li C,Chang PP,Ghebremariam KM,Qin L,Liang Y Overexpression of tomato SpMPK3 gene in Arabidopsis enhances the osmotic tolerance. Biochem. Biophys. Res. Commun., 2014. 443(2): p. 357-62 [PMID:24275141] Jaradat MR,Feurtado JA,Huang D,Lu Y,Cutler AJ Multiple roles of the transcription factor AtMYBR1/AtMYB44 in ABA signaling, stress responses, and leaf senescence. BMC Plant Biol., 2013. 13: p. 192 [PMID:24286353] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Li D, et al. Arabidopsis ABA receptor RCAR1/PYL9 interacts with an R2R3-type MYB transcription factor, AtMYB44. Int J Mol Sci, 2014. 15(5): p. 8473-90 [PMID:24828206] Xu DB, et al. A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis. PLoS ONE, 2015. 10(1): p. e0116385 [PMID:25635681] Hieno A, et al. Possible Involvement of MYB44-Mediated Stomatal Regulation in Systemic Resistance Induced by Penicillium simplicissimum GP17-2 in Arabidopsis. Microbes Environ., 2016. 31(2): p. 154-9 [PMID:27301421] Zhao Q, et al. AtMYB44 Positively Regulates the Enhanced Elongation of Primary Roots Induced by N-3-Oxo-Hexanoyl-Homoserine Lactone in Arabidopsis thaliana. Mol. Plant Microbe Interact., 2016. 29(10): p. 774-785 [PMID:27604593] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Nguyen NH,Cheong JJ H2A.Z-containing nucleosomes are evicted to activate AtMYB44 transcription in response to salt stress. Biochem. Biophys. Res. Commun., 2018. 499(4): p. 1039-1043 [PMID:29649476] Nguyen NH,Cheong JJ AtMYB44 interacts with TOPLESS-RELATED corepressors to suppress protein phosphatase 2C gene transcription. Biochem. Biophys. Res. Commun., 2018. 507(1-4): p. 437-442 [PMID:30448055]