PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zmw_sc01073.1.g00060.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 129aa MW: 14600.8 Da PI: 9.0349 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.4 | 6.8e-18 | 36 | 83 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+ Ed +l++++k++G+g+W+++ r g+ R++k+c++rw ++l Zmw_sc01073.1.g00060.1.sm.mk 36 KGPWTAAEDSILLEYIKKHGKGNWNAVQRNTGLSRCGKSCRLRWANHL 83 79******************************************9996 PP | |||||||
2 | Myb_DNA-binding | 28 | 5.2e-09 | 89 | 118 | 1 | 31 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartm 31 +g++T+eE+ l +++++++G++ W++ a ++ Zmw_sc01073.1.g00060.1.sm.mk 89 KGAFTPEEENLVIQLHHKMGNR-WAKMATRV 118 799*******************.***99887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 21.7 | 31 | 87 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.1E-23 | 33 | 86 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.9E-15 | 35 | 85 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.8E-16 | 36 | 83 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.59E-25 | 37 | 113 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.21E-11 | 38 | 83 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.6E-14 | 87 | 121 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 9.693 | 88 | 129 | IPR017930 | Myb domain |
SMART | SM00717 | 0.077 | 88 | 126 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.1E-8 | 89 | 118 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.00E-4 | 91 | 123 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 129 aa Download sequence Send to blast |
MNRVKSEDDC EMVLEDEMDS PPPAVVSPPS GPPQNKGPWT AAEDSILLEY IKKHGKGNWN 60 AVQRNTGLSR CGKSCRLRWA NHLRPNLKKG AFTPEEENLV IQLHHKMGNR WAKMATRVSC 120 RAYPLLCTY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 1e-21 | 11 | 115 | 2 | 105 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator of gibberellin-dependent alpha-amylase expression in aleurone cells. Involved in pollen and floral organs development. May bind to the 5'-TAACAAA-3' box of alpha-amylase promoter. {ECO:0000269|PubMed:9150608}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By gibberellin in aleurone cells. {ECO:0000269|PubMed:9150608}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004970317.1 | 2e-56 | transcription factor GAMYB | ||||
Swissprot | A2WW87 | 5e-54 | GAM1_ORYSI; Transcription factor GAMYB | ||||
TrEMBL | A0A0C6WCK4 | 4e-56 | A0A0C6WCK4_9POAL; ScMYB9 protein | ||||
TrEMBL | K3XG87 | 5e-55 | K3XG87_SETIT; Transcription factor | ||||
STRING | Si000907m | 8e-56 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3947 | 36 | 64 |