PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G366130_P01 | ||||||||
Common Name | LOC100284716 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 315aa MW: 33486.5 Da PI: 8.2969 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 53.3 | 4.8e-17 | 160 | 214 | 2 | 56 |
T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 rk+ +++keq Lee F+ +p+ +++ LA++l+L rqV vWFqNrRa+ k GRMZM2G366130_P01 160 RKKLRLSKEQSAFLEESFKVRATPNPKQKLALARQLNLRARQVEVWFQNRRARTK 214 788899***********************************************98 PP | |||||||
2 | HD-ZIP_I/II | 116.3 | 1.8e-37 | 160 | 250 | 1 | 92 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 +kk+rlskeq+++LEesF+ + + +p++K +lar+L+l++rqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+ en+rL+ke +eLr +lk GRMZM2G366130_P01 160 RKKLRLSKEQSAFLEESFKVRATPNPKQKLALARQLNLRARQVEVWFQNRRARTKLKQTEVDCEHLKRCCETLTGENRRLHKELAELR-ALK 250 69*************************************************************************************9.555 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 5.2E-17 | 147 | 210 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 9.84E-18 | 152 | 217 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 17.119 | 156 | 216 | IPR001356 | Homeobox domain |
SMART | SM00389 | 7.2E-14 | 158 | 220 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 1.4E-14 | 160 | 214 | IPR001356 | Homeobox domain |
CDD | cd00086 | 3.49E-14 | 160 | 217 | No hit | No description |
PROSITE pattern | PS00027 | 0 | 191 | 214 | IPR017970 | Homeobox, conserved site |
Pfam | PF02183 | 2.4E-10 | 216 | 250 | IPR003106 | Leucine zipper, homeobox-associated |
SMART | SM00340 | 6.8E-21 | 216 | 259 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 315 aa Download sequence Send to blast |
MADSGSDLVL GLGMGVGVRR EEETQRGRRD REARRELEFE TGRCARPSPE PAVRLTLLPG 60 LVPSLGLPWP LSSETNREVS TRGFDDVNRA LSVAGAGAEE DEAAVAAATA AASSSPNNSS 120 GSFAMDISAQ GQGQGQDQAA PAADRACSRA SDEDDGGSAR KKLRLSKEQS AFLEESFKVR 180 ATPNPKQKLA LARQLNLRAR QVEVWFQNRR ARTKLKQTEV DCEHLKRCCE TLTGENRRLH 240 KELAELRALK AVRPLLHMHL PATTLSMCPS CERVASTSSA APAAPAPASP SPAAGAGIAA 300 SAPDPDQRPS SSFAA |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 208 | 216 | RRARTKLKQ |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.127592 | 0.0 | shoot |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G366130 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G366130_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU969432 | 0.0 | EU969432.1 Zea mays clone 330060 homeobox-leucine zipper protein HAT14 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001151083.1 | 1e-144 | uncharacterized protein LOC100284716 | ||||
Swissprot | Q67UE2 | 1e-107 | HOX11_ORYSJ; Homeobox-leucine zipper protein HOX11 | ||||
TrEMBL | A0A1D6ERD2 | 0.0 | A0A1D6ERD2_MAIZE; Homeobox-leucine zipper protein HAT14 | ||||
STRING | GRMZM2G366130_P01 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP5209 | 33 | 63 | Representative plant | OGRP196 | 16 | 156 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G06710.1 | 2e-47 | homeobox from Arabidopsis thaliana |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G366130_P01 |