![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G175870_P02 | ||||||||
Common Name | LOC100274522 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 229aa MW: 24839.8 Da PI: 5.3457 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 31.4 | 4e-10 | 77 | 122 | 6 | 51 |
HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 + rr NReA r++R++Kka + Lee+vk+L a N++L+ +l+ GRMZM2G175870_P02 77 KPRRPLGNREAVRKYREKKKAHAAFLEEEVKKLRAANQQLQRRLQG 122 5688889**********************************99874 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 2.1E-16 | 70 | 140 | No hit | No description |
SMART | SM00338 | 6.0E-9 | 71 | 139 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF07716 | 1.0E-13 | 74 | 128 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 9.082 | 74 | 121 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 5.2E-8 | 78 | 122 | No hit | No description |
CDD | cd14686 | 1.94E-12 | 79 | 131 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 229 aa Download sequence Send to blast |
MDDGADLPCQ LLFSHPEMPD SFDEFFNSAT TTCTHTHSCN PPGPSVAMHT HTCLHAHTLV 60 LGSGGEDDDD AREDSAKPRR PLGNREAVRK YREKKKAHAA FLEEEVKKLR AANQQLQRRL 120 QGHAALEAEV ARLRGLLLDI RGKIDAEVGG VLPFQKPCSV GSVACADPAL CFNGNSEVGG 180 GWEESSRPAA ADCRIDEVRG MSREIDVPEG LRHSMDVVAS FVSSDPLAE |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G175870 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G175870_P02 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT043256 | 0.0 | BT043256.1 Zea mays full-length cDNA clone ZM_BFc0133G19 mRNA, complete cds. | |||
GenBank | BT060532 | 0.0 | BT060532.1 Zea mays full-length cDNA clone ZM_BFb0012N22 mRNA, complete cds. | |||
GenBank | BT087956 | 0.0 | BT087956.1 Zea mays full-length cDNA clone ZM_BFb0329N19 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001142351.1 | 1e-169 | uncharacterized protein LOC100274522 | ||||
Refseq | XP_020394445.1 | 1e-169 | putative bZIP transcription factor superfamily protein isoform X1 | ||||
Refseq | XP_020394446.1 | 1e-169 | putative bZIP transcription factor superfamily protein isoform X1 | ||||
Refseq | XP_020394447.1 | 1e-169 | putative bZIP transcription factor superfamily protein isoform X1 | ||||
Refseq | XP_020394448.1 | 1e-169 | putative bZIP transcription factor superfamily protein isoform X1 | ||||
Refseq | XP_020394449.1 | 1e-169 | putative bZIP transcription factor superfamily protein isoform X1 | ||||
Swissprot | Q8GTS2 | 1e-49 | BZP23_ARATH; Basic leucine zipper 23 | ||||
TrEMBL | B4G1L8 | 1e-168 | B4G1L8_MAIZE; Basic leucine zipper 24 | ||||
STRING | GRMZM2G175870_P01 | 1e-169 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G16770.1 | 1e-32 | bZIP family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G175870_P02 |
Entrez Gene | 100274522 |
Publications ? help Back to Top | |||
---|---|---|---|
|