![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01025155001 | ||||||||
Common Name | LOC100248443, VIT_06s0004g03160 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 90aa MW: 9935.84 Da PI: 10.3053 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 131.8 | 1.8e-41 | 24 | 89 | 5 | 70 |
S1FA 5 kveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 ++akG+nPGlivll+v glllvflvgny+lyvyaqk+lPPrkkkPvskkk+k+e+lkqGv++PGe GSVIVT01025155001 24 DADAKGFNPGLIVLLLVVGLLLVFLVGNYALYVYAQKTLPPRKKKPVSKKKMKKERLKQGVSAPGE 89 6789*************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD019013 | 0.001 | 21 | 89 | No hit | No description |
Pfam | PF04689 | 2.5E-40 | 25 | 89 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 90 aa Download sequence Send to blast |
MEEDFEFADK VPPSFERMGN VIKDADAKGF NPGLIVLLLV VGLLLVFLVG NYALYVYAQK 60 TLPPRKKKPV SKKKMKKERL KQGVSAPGE* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Vvi.2461 | 1e-140 | bud| fruit| inflorescence| leaf| stem |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FQ385037 | 1e-149 | FQ385037.1 Vitis vinifera clone SS0AEB3YJ10. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002285012.1 | 3e-57 | PREDICTED: DNA-binding protein S1FA | ||||
Refseq | XP_010651138.1 | 3e-57 | PREDICTED: DNA-binding protein S1FA | ||||
Refseq | XP_010651139.1 | 3e-57 | PREDICTED: DNA-binding protein S1FA | ||||
Swissprot | Q7XLX6 | 2e-16 | S1FA2_ORYSJ; DNA-binding protein S1FA2 | ||||
TrEMBL | D7SKV6 | 6e-56 | D7SKV6_VITVI; Uncharacterized protein | ||||
STRING | VIT_06s0004g03160.t01 | 1e-56 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5095 | 13 | 22 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01025155001 |
Entrez Gene | 100248443 |
Publications ? help Back to Top | |||
---|---|---|---|
|