PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01011168001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | Trihelix | ||||||||
Protein Properties | Length: 173aa MW: 20304.1 Da PI: 8.8026 | ||||||||
Description | Trihelix family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | trihelix | 80.2 | 3e-25 | 18 | 100 | 1 | 86 |
trihelix 1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 +W+ qe+++ + +r e+++++ ++k++k lWe +++km+e+g++rs+ qCk+kw+nl +ryk ++++e + ++++p++++l+ GSVIVT01011168001 18 QWSIQETKEFLMIRAELDRTFMETKRNKLLWEVIANKMKEKGYNRSADQCKCKWKNLVTRYKGCETMEPEA---MRQQFPFYNELQ 100 7********************************************************************95...56689*****98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
CDD | cd12203 | 2.19E-26 | 17 | 82 | No hit | No description |
Pfam | PF13837 | 3.6E-21 | 18 | 102 | No hit | No description |
PROSITE profile | PS50090 | 7.48 | 19 | 75 | IPR017877 | Myb-like domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0042802 | Molecular Function | identical protein binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MEGHHISVHI DTGDRFPQWS IQETKEFLMI RAELDRTFME TKRNKLLWEV IANKMKEKGY 60 NRSADQCKCK WKNLVTRYKG CETMEPEAMR QQFPFYNELQ AIFTARMQRM LWIEAEGGAK 120 KKGVQLSSED EDENEESEGE KGSSKKKKKG KTTKADERRH SMGMFSFEWG YV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2ebi_A | 6e-13 | 15 | 98 | 3 | 86 | DNA binding protein GT-1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Vvi.19740 | 0.0 | fruit |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Predominantly expressed in roots and flower buds. {ECO:0000269|PubMed:15044016}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that binds specifically to the core DNA sequence 5'-GTTAC-3'. {ECO:0000269|PubMed:15044016}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00481 | DAP | Transfer from AT5G01380 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM448719 | 1e-130 | AM448719.1 Vitis vinifera contig VV78X184874.7, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002264016.1 | 2e-91 | PREDICTED: trihelix transcription factor GT-3b | ||||
Swissprot | Q9SDW0 | 5e-55 | TGT3A_ARATH; Trihelix transcription factor GT-3a | ||||
TrEMBL | F6H6T6 | 2e-89 | F6H6T6_VITVI; Uncharacterized protein | ||||
STRING | VIT_08s0105g00400.t01 | 3e-90 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP2262 | 15 | 35 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38250.1 | 4e-56 | Trihelix family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01011168001 |