![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi09g05300.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 151aa MW: 16450.6 Da PI: 10.0444 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 79.4 | 5.2e-25 | 86 | 134 | 1 | 49 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49 +Cq+egC+adls+ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsr Vradi09g05300.1 86 RCQAEGCNADLSQAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQCSRL 134 6**********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 6.4E-26 | 80 | 134 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 19.828 | 84 | 150 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 9.55E-24 | 85 | 137 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 9.7E-19 | 87 | 134 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009554 | Biological Process | megasporogenesis | ||||
GO:0009556 | Biological Process | microsporogenesis | ||||
GO:0048653 | Biological Process | anther development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 151 aa Download sequence Send to blast |
MLSLDPLPHV NAANCGPGPG PGPGGLLLVP KSEDVGRPMD FVGSRIGLNL GGRTYFSSSE 60 DDFVSRLYRR SRPAESGSAA SSNSPRCQAE GCNADLSQAK HYHRRHKVCE FHSKAATVIA 120 AGLTQRFCQQ CSRLWWRLSL PHRRKININH * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 2e-18 | 77 | 134 | 1 | 58 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. Binds specifically to the 5'-GTAC-3' core sequence. Involved in development and floral organogenesis. Required for ovule differentiation, pollen production, filament elongation, seed formation and siliques elongation. Also seems to play a role in the formation of trichomes on sepals. May positively modulate gibberellin (GA) signaling in flower. {ECO:0000269|PubMed:12671094, ECO:0000269|PubMed:16095614, ECO:0000269|PubMed:17093870}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00090 | SELEX | Transfer from AT1G02065 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi09g05300.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015042 | 0.0 | AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027906991.1 | 5e-93 | squamosa promoter-binding-like protein 8 | ||||
Swissprot | Q8GXL3 | 7e-54 | SPL8_ARATH; Squamosa promoter-binding-like protein 8 | ||||
TrEMBL | A0A4D6MXP2 | 1e-91 | A0A4D6MXP2_VIGUN; Transcription factor | ||||
STRING | XP_004510109.1 | 8e-79 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6801 | 33 | 48 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G02065.2 | 7e-57 | squamosa promoter binding protein-like 8 |
Publications ? help Back to Top | |||
---|---|---|---|
|