![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi08g15530.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 172aa MW: 18679.9 Da PI: 6.5176 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 176.5 | 2.5e-55 | 26 | 119 | 2 | 95 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 reqdrflPian+srimkk lP n+ki+kdak+t+qecvsefisfvtseas+kcq+ekrktingddllwa+atlGfedy+eplkvyl++yre ++ Vradi08g15530.1 26 REQDRFLPIANISRIMKKGLPPNGKIAKDAKDTMQECVSEFISFVTSEASEKCQKEKRKTINGDDLLWAMATLGFEDYIEPLKVYLARYREGDT 119 89****************************************************************************************9665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 7.0E-52 | 23 | 122 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.35E-39 | 28 | 124 | IPR009072 | Histone-fold |
Pfam | PF00808 | 5.5E-29 | 31 | 95 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.7E-21 | 59 | 77 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 62 | 78 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.7E-21 | 78 | 96 | No hit | No description |
PRINTS | PR00615 | 1.7E-21 | 97 | 115 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 172 aa Download sequence Send to blast |
MSDAPASPSH ESGGEQSPRA FSSGAREQDR FLPIANISRI MKKGLPPNGK IAKDAKDTMQ 60 ECVSEFISFV TSEASEKCQK EKRKTINGDD LLWAMATLGF EDYIEPLKVY LARYREGDTK 120 GSARGGDGSA RPDQVGLAGQ NSQLVHQGSL NYISLQVQPQ HLVIPSMQSH E* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 5e-48 | 26 | 116 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 5e-48 | 26 | 116 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi08g15530.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FJ775529 | 1e-141 | FJ775529.1 Glycine max CCAAT-binding transcription factor family protein (NF-YB1a) mRNA, complete cds. | |||
GenBank | FJ775530 | 1e-141 | FJ775530.1 Glycine max CCAAT-binding transcription factor family protein (NF-YB1b) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014512284.1 | 1e-124 | nuclear transcription factor Y subunit B-1 isoform X2 | ||||
Refseq | XP_022641061.1 | 1e-124 | nuclear transcription factor Y subunit B-1 isoform X2 | ||||
Swissprot | Q8VYK4 | 6e-77 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A1S3V2A9 | 1e-123 | A0A1S3V2A9_VIGRR; nuclear transcription factor Y subunit B-1 isoform X2 | ||||
STRING | XP_007144163.1 | 1e-120 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2545 | 33 | 82 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 3e-79 | nuclear factor Y, subunit B8 |
Publications ? help Back to Top | |||
---|---|---|---|
|