![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi02g04720.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 187aa MW: 21394.4 Da PI: 6.3985 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 96.5 | 2e-30 | 74 | 127 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 +prl+Wtp+LH+rFv++v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl Vradi02g04720.1 74 RPRLVWTPQLHKRFVDVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 127 59*******************.********************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 10.507 | 71 | 130 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.09E-20 | 72 | 131 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 7.8E-31 | 73 | 132 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 6.0E-24 | 75 | 127 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 2.2E-8 | 77 | 126 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007623 | Biological Process | circadian rhythm | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 187 aa Download sequence Send to blast |
MGEEVKTSEY DEERVMEWEV GLPTANDLTP LSQPLIPPEL ATAFSISPEP HRTALDADSA 60 VRTENSAERT AVKRPRLVWT PQLHKRFVDV VAHLGIKNAV PKTIMQLMNV EGLTRENVAS 120 HLQKYRLYLK RMQGLSNEVY EEDHVELDYN LSQMVYPVHR FANFLARISN SCHLITRILA 180 YFFWSA* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5lxu_A | 2e-35 | 74 | 130 | 1 | 57 | Transcription factor LUX |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that is essential for the generation of the circadian clock oscillation. Binds to specific sites on CCA1 promoter leading to CCA1 activation (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi02g04720.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian oscillation with peaks at subjective dusk. {ECO:0000269|PubMed:16164597}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015039 | 1e-135 | AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004507164.1 | 9e-64 | transcription factor PCL1 | ||||
Refseq | XP_004507165.1 | 9e-64 | transcription factor PCL1 | ||||
Refseq | XP_017243827.1 | 6e-64 | PREDICTED: transcription factor PCL1-like | ||||
Swissprot | Q94DH3 | 3e-56 | PCL1_ORYSJ; Transcription factor PCL1 | ||||
TrEMBL | A0A2P5VRQ2 | 3e-63 | A0A2P5VRQ2_GOSBA; Uncharacterized protein | ||||
STRING | XP_004507164.1 | 3e-63 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6957 | 33 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G59570.1 | 2e-53 | G2-like family protein |