![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi01g01740.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 79aa MW: 8114.32 Da PI: 7.7399 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 74.5 | 1.5e-23 | 20 | 65 | 14 | 60 |
ZF-HD_dimer 14 AaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 a++Gg+avDGC+Efm+s g egt+aal+CaACgCHRnFH+r+ve+e Vradi01g01740.1 20 TANVGGYAVDGCREFMAS-GGEGTTAALTCAACGCHRNFHKRQVETE 65 699**************9.8889*******************99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51523 | 16.312 | 1 | 61 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 9.4E-22 | 20 | 62 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 5.4E-18 | 20 | 61 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
ProDom | PD125774 | 5.0E-11 | 21 | 75 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 79 aa Download sequence Send to blast |
MGGLMKMHAN KGIIVSFCRT ANVGGYAVDG CREFMASGGE GTTAALTCAA CGCHRNFHKR 60 QVETEVVCEC SSPPSIGT* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi01g01740.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015044 | 2e-90 | AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014508009.1 | 7e-36 | mini zinc finger protein 2 | ||||
Refseq | XP_017438792.1 | 7e-36 | PREDICTED: mini zinc finger protein 2 | ||||
Swissprot | Q9LJW5 | 1e-27 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
TrEMBL | A0A0L9VPI3 | 2e-34 | A0A0L9VPI3_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A0S3T8H5 | 2e-34 | A0A0S3T8H5_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A1S3UPZ8 | 2e-34 | A0A1S3UPZ8_VIGRR; mini zinc finger protein 2 | ||||
STRING | XP_007151284.1 | 3e-34 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1550 | 34 | 100 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 1e-17 | mini zinc finger 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|