![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi0161s00220.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 157aa MW: 17857.2 Da PI: 9.6381 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 122.4 | 1.5e-38 | 39 | 96 | 2 | 59 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 ++++++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvP+G+grrk k Vradi0161s00220.1 39 PDRIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPIGAGRRKAK 96 68899***************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF02701 | 6.6E-32 | 42 | 96 | IPR003851 | Zinc finger, Dof-type |
ProDom | PD007478 | 6.0E-27 | 42 | 96 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.155 | 43 | 97 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 45 | 81 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:1902455 | Biological Process | negative regulation of stem cell population maintenance | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 157 aa Download sequence Send to blast |
MAKVQSGQAS EGIKLFGTTI TLHGRETRED DKESEEKKPD RIIPCPRCKS METKFCYFNN 60 YNVNQPRHFC KGCQRYWTAG GALRNVPIGA GRRKAKPPCH DPTGFLDAST VQQQFGLEDK 120 LILDQWHVAT ITHDDFRQFF PSKRRRINSG GQRQPC* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 142 | 146 | KRRRI |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi0161s00220.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015034 | 0.0 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014523489.2 | 1e-111 | cyclic dof factor 4 | ||||
Swissprot | O22967 | 5e-55 | CDF4_ARATH; Cyclic dof factor 4 | ||||
TrEMBL | A0A1S3VZL4 | 1e-110 | A0A1S3VZL4_VIGRR; cyclic dof factor 4 | ||||
STRING | XP_007159448.1 | 2e-89 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6483 | 32 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G34140.1 | 6e-50 | Dof family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|