PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010544870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family HD-ZIP
Protein Properties Length: 239aa    MW: 27411.6 Da    PI: 4.7048
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010544870.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.74.6e-193891356
                    --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    + ++ft+eq++ Le +Fe++  +  +++ +LA++lgL+ rqV +WFqN+Ra++k
  XP_010544870.1 38 NQRRFTDEQIKSLELMFESETRLEPRKKVQLARELGLQPRQVAIWFQNKRARWK 91
                    5679*************************************************9 PP

2HD-ZIP_I/II121.54.3e-3938129293
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     ++rr+++eq+k+LE +Fe+e++Lep++Kv+lareLglqprqva+WFqn+RAR+k+kqlEk+y+ L+++y++l+++ ++L+ke+++L +el++
  XP_010544870.1  38 NQRRFTDEQIKSLELMFESETRLEPRKKVQLARELGLQPRQVAIWFQNKRARWKSKQLEKEYNILRANYNNLASQCDALKKEKQALVSELQR 129
                     68**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.01E-191695IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-192893IPR009057Homeodomain-like
SMARTSM003891.2E-153197IPR001356Homeobox domain
PROSITE profilePS5007117.5243393IPR001356Homeobox domain
PfamPF000462.3E-163891IPR001356Homeobox domain
CDDcd000861.93E-153994No hitNo description
PRINTSPR000316.9E-66473IPR000047Helix-turn-helix motif
PROSITE patternPS0002706891IPR017970Homeobox, conserved site
PRINTSPR000316.9E-67389IPR000047Helix-turn-helix motif
PfamPF021834.3E-1693135IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MSERGEYSPA TIPGMTADPF SCINELGAMA MKKKKCKNQR RFTDEQIKSL ELMFESETRL  60
EPRKKVQLAR ELGLQPRQVA IWFQNKRARW KSKQLEKEYN ILRANYNNLA SQCDALKKEK  120
QALVSELQRL NELMQKTEEG QCYGQGVALS STDHESDNGE NTRYQTEVKP GKYENGPGVL  180
SDDDNIKTEY FGFEEDPDLM GMVEPADSSL TSSDDWGGFK SDALLDQSSS NYPWWDFWS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription activator that may act as growth regulators in response to water deficit. {ECO:0000269|PubMed:15604708, ECO:0000269|PubMed:8771791}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010544870.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By water deficit, by abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:8771791}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010544870.11e-179PREDICTED: homeobox-leucine zipper protein ATHB-7-like
SwissprotP468971e-100ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7
TrEMBLR0HUH22e-97R0HUH2_9BRAS; Uncharacterized protein
STRINGXP_010544870.11e-179(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24982874
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.11e-102homeobox 7
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhou SF, et al.
    Membrane-associated transcription factor peptidase, site-2 protease, antagonizes ABA signaling in Arabidopsis.
    New Phytol., 2015. 208(1): p. 188-97
    [PMID:25919792]