![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thecc1EG029596t1 | ||||||||
Common Name | TCM_029596 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 295aa MW: 34012.8 Da PI: 10.2112 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 98.9 | 2.1e-31 | 77 | 126 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+ Thecc1EG029596t1 77 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 126 79***********************************************8 PP | |||||||
2 | K-box | 114.5 | 1e-37 | 145 | 241 | 4 | 100 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 s++ s++ea+a+ +qqe+akL+ +i nLq+++Rh+lGe+L+ L +k+L++Le++Lek++++iRskKnell+++ie++qk+e +l+++n+ Lr+ Thecc1EG029596t1 145 SNTGSVSEANAQFYQQEAAKLRVQIGNLQNSNRHMLGESLSALPMKDLRSLENRLEKGISRIRSKKNELLFAEIEYMQKREIDLHNNNQLLRA 237 444459*************************************************************************************** PP K-box 97 klee 100 k++e Thecc1EG029596t1 238 KIAE 241 *986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 34.132 | 69 | 129 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.1E-42 | 69 | 128 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.28E-45 | 70 | 146 | No hit | No description |
SuperFamily | SSF55455 | 4.71E-33 | 70 | 142 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 71 | 125 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.9E-33 | 71 | 91 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.2E-26 | 78 | 125 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.9E-33 | 91 | 106 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.9E-33 | 106 | 127 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.3E-27 | 153 | 239 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.178 | 155 | 245 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048366 | Biological Process | leaf development | ||||
GO:0048440 | Biological Process | carpel development | ||||
GO:0048443 | Biological Process | stamen development | ||||
GO:0048497 | Biological Process | maintenance of floral organ identity | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 295 aa Download sequence Send to blast |
MTFNAKDLDD AKTFLGRTKT KSGKARRRND HRWMERTKDQ ISCDRFLIQT LAIMVYPNES 60 CETSPQKKMG RGKIEIKRIE NTTNRQVTFC KRRNGLLKKA YELSVLCDAE VALIVFSSRG 120 RLYEYANNSV KATIERYKKT CADSSNTGSV SEANAQFYQQ EAAKLRVQIG NLQNSNRHML 180 GESLSALPMK DLRSLENRLE KGISRIRSKK NELLFAEIEY MQKREIDLHN NNQLLRAKIA 240 ENERKQQNIN LMPGGSNFEI MHSQPFDSRN YFQVNALQPA NHYPHQDQMA LQLV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 1e-20 | 69 | 137 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-20 | 69 | 137 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-20 | 69 | 137 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 1e-20 | 69 | 137 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_A | 1e-20 | 69 | 137 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 1e-20 | 69 | 137 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 1e-20 | 69 | 137 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 1e-20 | 69 | 137 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 1e-20 | 69 | 137 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 1e-20 | 69 | 137 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}. | |||||
UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00609 | ChIP-seq | Transfer from AT4G18960 | Download |
![]() |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | DQ157163 | 0.0 | DQ157163.1 Theobroma cacao AGAMOUS-like protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007025252.1 | 1e-180 | PREDICTED: floral homeotic protein AGAMOUS | ||||
Refseq | XP_017978806.1 | 1e-180 | PREDICTED: floral homeotic protein AGAMOUS | ||||
Refseq | XP_017978807.1 | 1e-180 | PREDICTED: floral homeotic protein AGAMOUS | ||||
Swissprot | Q40872 | 1e-135 | AG_PANGI; Floral homeotic protein AGAMOUS | ||||
Swissprot | Q40885 | 1e-135 | AG_PETHY; Floral homeotic protein AGAMOUS | ||||
TrEMBL | A0A061GFD3 | 0.0 | A0A061GFD3_THECC; K-box region and MADS-box transcription factor family protein isoform 1 | ||||
STRING | EOY27872 | 0.0 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6181 | 22 | 37 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18960.1 | 1e-128 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thecc1EG029596t1 |
Entrez Gene | 18596599 |
Publications ? help Back to Top | |||
---|---|---|---|
|