PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG014345t2
Common NameTCM_014345
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family MIKC_MADS
Protein Properties Length: 220aa    MW: 25900.8 Da    PI: 10.1307
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG014345t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.17.6e-3159109151
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                       krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gkl+eys+
  Thecc1EG014345t2  59 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYST 109
                       79***********************************************96 PP

2K-box95.67.6e-32126208284
             K-box   2 qkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkke 84 
                       ++++   +e  ++ s++ e+akLk+++e Lqr+qRh++GedL++Lsl+eLq+LeqqL+++lk++Rs+Kn+l++e+i+elqkk 
  Thecc1EG014345t2 126 AERQLAGNEVDQNGSWTLEHAKLKARMEVLQRNQRHFMGEDLDNLSLRELQNLEQQLDSALKHVRSRKNQLMFESISELQKKH 208
                       55666777788899*******************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.5251111IPR002100Transcription factor, MADS-box
SMARTSM004326.9E-4051110IPR002100Transcription factor, MADS-box
CDDcd002651.13E-4052129No hitNo description
SuperFamilySSF554556.41E-3452137IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-315373IPR002100Transcription factor, MADS-box
PROSITE patternPS00350053107IPR002100Transcription factor, MADS-box
PfamPF003192.1E-2560107IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-317388IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-3188109IPR002100Transcription factor, MADS-box
PfamPF014862.8E-25134208IPR002487Transcription factor, K-box
PROSITE profilePS5129714.742138219IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010154Biological Processfruit development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
LKIPRESEQE REQTLSPLSL PELTVSFLFL GCCQWSWWRP FARQKGKDII MGRGRVQLKR  60
IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIVFST KGKLFEYSTD SCMERILERY  120
ERYSYAERQL AGNEVDQNGS WTLEHAKLKA RMEVLQRNQR HFMGEDLDNL SLRELQNLEQ  180
QLDSALKHVR SRKNQLMFES ISELQKKHCK SRITCLQRR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A7e-2251124173MEF2 CHIMERA
6byy_B7e-2251124173MEF2 CHIMERA
6byy_C7e-2251124173MEF2 CHIMERA
6byy_D7e-2251124173MEF2 CHIMERA
6bz1_A8e-2251124173MEF2 CHIMERA
6bz1_B8e-2251124173MEF2 CHIMERA
6bz1_C8e-2251124173MEF2 CHIMERA
6bz1_D8e-2251124173MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM2364371e-178HM236437.1 UNVERIFIED: Gossypium hirsutum MADS21-like mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017973951.11e-109PREDICTED: agamous-like MADS-box protein AGL8 homolog isoform X3
SwissprotQ6E6S71e-93AP1_VITVI; Agamous-like MADS-box protein AP1
TrEMBLA0A061FZ331e-159A0A061FZ33_THECC; K-box region and MADS-box transcription factor family protein isoform 2 (Fragment)
STRINGEOY221351e-108(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.19e-92AGAMOUS-like 8
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  4. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]