![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thecc1EG008716t1 | ||||||||
Common Name | TCM_008716 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 199aa MW: 22988.2 Da PI: 6.1589 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 89.7 | 1.6e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krie+ks rqvtfskRr g++KKA ELSvLCd+e+a++ifss+g+lye+ss Thecc1EG008716t1 9 KRIEDKSSRQVTFSKRRSGLIKKARELSVLCDVEIALVIFSSRGRLYEFSS 59 79***********************************************96 PP | |||||||
2 | K-box | 46.3 | 1.8e-16 | 76 | 162 | 12 | 98 |
K-box 12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 +++e ++ + L++ +e L q +l ++e+Lsl +L +Le+qL+ +l++ R++K++l++e+i +lq+kek l+ en+ L+++ Thecc1EG008716t1 76 QESEASKDVNEALRSHTELLHIVQSQLEEPNVEQLSLMDLVNLEKQLDMALSETRARKTQLMMESIMTLQEKEKLLRAENELLERES 162 4555555556678999999999999999999****************************************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.721 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.3E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.83E-30 | 2 | 77 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.24E-37 | 2 | 71 | No hit | No description |
PRINTS | PR00404 | 1.7E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.5E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.7E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.7E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 11.81 | 78 | 168 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.1E-12 | 81 | 161 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009910 | Biological Process | negative regulation of flower development | ||||
GO:0010048 | Biological Process | vernalization response | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 199 aa Download sequence Send to blast |
MGRRKVQMKR IEDKSSRQVT FSKRRSGLIK KARELSVLCD VEIALVIFSS RGRLYEFSSA 60 DGLTKILERY RCHYEQESEA SKDVNEALRS HTELLHIVQS QLEEPNVEQL SLMDLVNLEK 120 QLDMALSETR ARKTQLMMES IMTLQEKEKL LRAENELLER ESAAMEKNED EGNEVVIGFS 180 NHQYLGNLRQ QQTLSLLQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 4e-24 | 1 | 88 | 1 | 88 | MEF2C |
5f28_B | 4e-24 | 1 | 88 | 1 | 88 | MEF2C |
5f28_C | 4e-24 | 1 | 88 | 1 | 88 | MEF2C |
5f28_D | 4e-24 | 1 | 88 | 1 | 88 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the negative regulation of flowering time, probably through the photoperiodic and vernalization pathways; more efficient in cv. Landsberg erecta than in cv. Columbia background. Prevents premature flowering (PubMed:12724541, PubMed:25339407). Involved in the modulation of vernalization impact on flowering according to genotype acclimation to altitude (PubMed:25339407). {ECO:0000269|PubMed:12724541, ECO:0000269|PubMed:25339407}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed during vernalization (PubMed:12724541). Regulated by HAM1 and HAM2 via epigenetic modification of chromatins at H4K5 acetylation during flowering (PubMed:23273925). {ECO:0000269|PubMed:12724541, ECO:0000269|PubMed:23273925}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007043954.2 | 1e-140 | PREDICTED: agamous-like MADS-box protein AGL27 isoform X1 | ||||
Swissprot | Q9LSR7 | 4e-54 | AGL70_ARATH; Agamous-like MADS-box protein AGL70 | ||||
TrEMBL | A0A061E4A0 | 1e-139 | A0A061E4A0_THECC; Flowering locus C, putative isoform 1 | ||||
STRING | EOX99786 | 1e-133 | (Theobroma cacao) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G65060.1 | 1e-50 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thecc1EG008716t1 |
Entrez Gene | 18608962 |
Publications ? help Back to Top | |||
---|---|---|---|
|