PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thecc1EG007378t1 | ||||||||
Common Name | TCM_007378 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 220aa MW: 24754.1 Da PI: 9.5084 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 87.9 | 5.4e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n+ rqvtfskRr g++KKA+ELS+LCdae+a+++fs tgkl+eyss Thecc1EG007378t1 9 KKIDNTAARQVTFSKRRRGLFKKAHELSTLCDAEIALVVFSATGKLFEYSS 59 68***********************************************96 PP | |||||||
2 | K-box | 56.5 | 1.2e-19 | 84 | 171 | 11 | 98 |
K-box 11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 + +++ + +a L kei + re+Rhl Ge+L+ L+l+eL++Le+ Le +l+++ ++K+e +l++i++l++k el een++L++++ Thecc1EG007378t1 84 SLEMQIESSAHAMLGKEIAEKNRELRHLRGEELQGLNLEELKHLEKLLEAGLSRVTETKDERFLKEISNLKRKGAELMEENQQLKQQI 171 5566777788889999999999****************************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.6E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 29.66 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.06E-29 | 2 | 70 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.1E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.04E-38 | 3 | 68 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.9E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.1E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.1E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 12.96 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 9.4E-16 | 93 | 171 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 220 aa Download sequence Send to blast |
MTRQKIQIKK IDNTAARQVT FSKRRRGLFK KAHELSTLCD AEIALVVFSA TGKLFEYSST 60 STGQVIERRN LQSERTNGLD RVPSLEMQIE SSAHAMLGKE IAEKNRELRH LRGEELQGLN 120 LEELKHLEKL LEAGLSRVTE TKDERFLKEI SNLKRKGAEL MEENQQLKQQ IGNSSMDQAI 180 VPQQGQPSES AARVWISADP PQGYNNSDIS LRLGLPFPN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-20 | 1 | 66 | 1 | 66 | MEF2C |
5f28_B | 2e-20 | 1 | 66 | 1 | 66 | MEF2C |
5f28_C | 2e-20 | 1 | 66 | 1 | 66 | MEF2C |
5f28_D | 2e-20 | 1 | 66 | 1 | 66 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007042844.2 | 1e-158 | PREDICTED: MADS-box protein SVP | ||||
Refseq | XP_017970109.1 | 1e-158 | PREDICTED: MADS-box protein SVP | ||||
Swissprot | Q9FVC1 | 5e-78 | SVP_ARATH; MADS-box protein SVP | ||||
TrEMBL | A0A061E173 | 1e-158 | A0A061E173_THECC; MIKC mads-box transcription factor, putative isoform 1 | ||||
STRING | EOX98675 | 1e-159 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM22221 | 4 | 5 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 9e-65 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thecc1EG007378t1 |
Entrez Gene | 18608209 |