| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | SRF-TF | 86.6 | 1.4e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+i+n + rqvtfskRr g++KKAeELS+LCda+va++ifsstgkl+ y+s
Thecc1EG000992t1 9 KKIDNATARQVTFSKRRRGLFKKAEELSILCDADVALVIFSSTGKLFQYAS 59
68***********************************************86 PP
|
| 2 | K-box | 44.1 | 8.8e-16 | 98 | 171 | 25 | 98 |
K-box 25 kkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98
ke+ + +++R++ Ge+L+ Ls++eLqqLe+ Le++l+++ +kK + ++++i++lq+k l een++L+ ++
Thecc1EG000992t1 98 SKEVAEKSHQLRQMRGEELQGLSIEELQQLEKSLESGLSRVIEKKGQKIMREINDLQRKGMHLMEENERLKLQI 171
44444445889***********************************************************9876 PP
|
| Protein Features
? help Back to Top |
 |
| Database |
Entry ID |
E-value |
Start |
End |
InterPro ID |
Description |
| SMART | SM00432 | 4.7E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 30.039 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 5.32E-39 | 2 | 77 | No hit | No description |
| SuperFamily | SSF55455 | 6.02E-31 | 3 | 78 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.8E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 6.6E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.8E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.8E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS51297 | 12.919 | 87 | 177 | IPR002487 | Transcription factor, K-box |
| Pfam | PF01486 | 7.6E-16 | 95 | 170 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0009266 | Biological Process | response to temperature stimulus |
| GO:0009910 | Biological Process | negative regulation of flower development |
| GO:0010076 | Biological Process | maintenance of floral meristem identity |
| GO:0010582 | Biological Process | floral meristem determinacy |
| GO:0017148 | Biological Process | negative regulation of translation |
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated |
| GO:0048438 | Biological Process | floral whorl development |
| GO:0005634 | Cellular Component | nucleus |
| GO:0000900 | Molecular Function | translation repressor activity, nucleic acid binding |
| GO:0003677 | Molecular Function | DNA binding |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| GO:0046983 | Molecular Function | protein dimerization activity |
| Publications
? help Back to Top |
- Motamayor JC, et al.
The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
Genome Biol., 2013. 14(6): p. r53
[PMID:23731509] - Ramamoorthy R,Phua EE,Lim SH,Tan HT,Kumar PP
Identification and characterization of RcMADS1, an AGL24 ortholog from the holoparasitic plant Rafflesia cantleyi Solms-Laubach (Rafflesiaceae).
PLoS ONE, 2013. 8(6): p. e67243
[PMID:23840638] - Jaudal M, et al.
Overexpression of Medicago SVP genes causes floral defects and delayed flowering in Arabidopsis but only affects floral development in Medicago.
J. Exp. Bot., 2014. 65(2): p. 429-42
[PMID:24249713] - Müller-Xing R,Clarenz O,Pokorny L,Goodrich J,Schubert D
Polycomb-Group Proteins and FLOWERING LOCUS T Maintain Commitment to Flowering in Arabidopsis thaliana.
Plant Cell, 2014. 26(6): p. 2457-2471
[PMID:24920331] - Nakano T,Kato H,Shima Y,Ito Y
Apple SVP Family MADS-Box Proteins and the Tomato Pedicel Abscission Zone Regulator JOINTLESS have Similar Molecular Activities.
Plant Cell Physiol., 2015. 56(6): p. 1097-106
[PMID:25746985] - Hwan Lee J,Sook Chung K,Kim SK,Ahn JH
Post-translational regulation of SHORT VEGETATIVE PHASE as a major mechanism for thermoregulation of flowering.
Plant Signal Behav, 2014. 9(4): p. e28193
[PMID:25764420] - Chen Z, et al.
Overexpression of AtAP1M3 regulates flowering time and floral development in Arabidopsis and effects key flowering-related genes in poplar.
Transgenic Res., 2015. 24(4): p. 705-15
[PMID:25820621] - Wells CE,Vendramin E,Jimenez Tarodo S,Verde I,Bielenberg DG
A genome-wide analysis of MADS-box genes in peach [Prunus persica (L.) Batsch].
BMC Plant Biol., 2015. 15: p. 41
[PMID:25848674] - Müller-Xing R,Schubert D,Goodrich J
Non-inductive conditions expose the cryptic bract of flower phytomeres in Arabidopsis thaliana.
Plant Signal Behav, 2015. 10(4): p. e1010868
[PMID:25924005] - Marín-González E, et al.
SHORT VEGETATIVE PHASE Up-Regulates TEMPRANILLO2 Floral Repressor at Low Ambient Temperatures.
Plant Physiol., 2015. 169(2): p. 1214-24
[PMID:26243615] - Bechtold U, et al.
Time-Series Transcriptomics Reveals That AGAMOUS-LIKE22 Affects Primary Metabolism and Developmental Processes in Drought-Stressed Arabidopsis.
Plant Cell, 2016. 28(2): p. 345-66
[PMID:26842464] - Fernández V,Takahashi Y,Le Gourrierec J,Coupland G
Photoperiodic and thermosensory pathways interact through CONSTANS to promote flowering at high temperature under short days.
Plant J., 2016. 86(5): p. 426-40
[PMID:27117775] - Wilson DC,Kempthorne CJ,Carella P,Liscombe DK,Cameron RK
Age-Related Resistance in Arabidopsis thaliana Involves the MADS-Domain Transcription Factor SHORT VEGETATIVE PHASE and Direct Action of Salicylic Acid on Pseudomonas syringae.
Mol. Plant Microbe Interact., 2017. 30(11): p. 919-929
[PMID:28812948] - Zou YP, et al.
Adaptation of Arabidopsis thaliana to the Yangtze River basin.
Genome Biol., 2017. 18(1): p. 239
[PMID:29284515] - Richter R, et al.
Floral regulators FLC and SOC1 directly regulate expression of the B3-type transcription factor TARGET OF FLC AND SVP 1 at the Arabidopsis shoot apex via antagonistic chromatin modifications.
PLoS Genet., 2019. 15(4): p. e1008065
[PMID:30946745]
|
