PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG000931t1
Common NameTCM_000931
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family MIKC_MADS
Protein Properties Length: 251aa    MW: 29034.1 Da    PI: 9.4677
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG000931t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.33.6e-271059251
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      ri+n++ rqvtfskRr+g++KKA+EL +LCdaev ++ifsstgklye++s
  Thecc1EG000931t1 10 RIDNSTSRQVTFSKRRKGLIKKAKELAILCDAEVGLVIFSSTGKLYEFAS 59
                      8***********************************************86 PP

2K-box81.42.2e-271031871498
             K-box  14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                       a+ +q+e+a L+++++nLq+++R+l+Ge+L+ L +++Lq+Le+qLe sl+ +R kK+++l+++i+el ++ + +++en +L kk+
  Thecc1EG000931t1 103 AKFWQREAAILRQQLQNLQENHRQLMGEQLHGLGVEDLQNLENQLEMSLRGVRMKKERILTDEIQELSQRGNIIHQENVELYKKV 187
                       589*******************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.0E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.497161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-32282IPR002100Transcription factor, MADS-box
CDDcd002653.12E-44278No hitNo description
PRINTSPR004045.9E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.2E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-283859IPR002100Transcription factor, MADS-box
PfamPF014861.3E-25103187IPR002487Transcription factor, K-box
PROSITE profilePS5129714.691103193IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRKGLIK KAKELAILCD AEVGLVIFSS TGKLYEFAST  60
SMKSVIERYN SLKEEHQQLL NPSLEVKVKF SPLFFCINEN WYAKFWQREA AILRQQLQNL  120
QENHRQLMGE QLHGLGVEDL QNLENQLEMS LRGVRMKKER ILTDEIQELS QRGNIIHQEN  180
VELYKKVNLM RKENMELYKK VYGTRNVNTS DGNALTSYCF DSGEGSHVPV HLQLSQPEPQ  240
NYDTPNRSKD *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-22184184MEF2C
5f28_B2e-22184184MEF2C
5f28_C2e-22184184MEF2C
5f28_D2e-22184184MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021301128.11e-163MADS-box transcription factor 23-like
SwissprotQ9SZJ61e-104AGL21_ARATH; Agamous-like MADS-box protein AGL21
TrEMBLA0A061DIY20.0A0A061DIY2_THECC; AGAMOUS-like 21, putative
STRINGEOX918710.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53024105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.11e-106AGAMOUS-like 21
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  3. Yu LH, et al.
    Arabidopsis MADS-Box Transcription Factor AGL21 Acts as Environmental Surveillance of Seed Germination by Regulating ABI5 Expression.
    Mol Plant, 2017. 10(6): p. 834-845
    [PMID:28438576]
  4. Qu Y, et al.
    Peroxisomal CuAO╬ and its product H2O2 regulate the distribution of auxin and IBA-dependent lateral root development in Arabidopsis.
    J. Exp. Bot., 2017. 68(17): p. 4851-4867
    [PMID:28992128]
  5. Sun CH, et al.
    Chrysanthemum MADS-box transcription factor CmANR1 modulates lateral root development via homo-/heterodimerization to influence auxin accumulation in Arabidopsis.
    Plant Sci., 2018. 266: p. 27-36
    [PMID:29241564]