![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400006021 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | TCP | ||||||||
Protein Properties | Length: 158aa MW: 18036.5 Da PI: 10.2041 | ||||||||
Description | TCP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCP | 92.3 | 1e-28 | 71 | 137 | 3 | 69 |
TCP 3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssss 69 +++++ ski T++g+RdRR+Rls+ a++fFdLq+ LGfdk+skti+WL++ ++ a elt+ s+ + PGSC0003DMP400006021 71 KRERSCSKILTAQGPRDRRIRLSIAMARKFFDLQELLGFDKPSKTIDWLFTHSQVALEELTNWSTHQ 137 577888*******************************************************985554 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51369 | 28.101 | 71 | 130 | IPR017887 | Transcription factor TCP subgroup |
Pfam | PF03634 | 1.3E-27 | 77 | 136 | IPR005333 | Transcription factor, TCP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
MFSASNSSTH DNPLPQYISS SFHTSSPFVG LNGNQILLHQ YYQNQFSSHY LAKNNCVDSL 60 RSFPMKKKPK KRERSCSKIL TAQGPRDRRI RLSIAMARKF FDLQELLGFD KPSKTIDWLF 120 THSQVALEEL TNWSTHQTQI SGLILALTII KYQNEPS* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Retards growth rate and reduces organ number in the dorsal region of flowers. Binds specifically to the DNA sequence 5'-GGNCCCNC-3', and is able to bind to the RAD promoter sequence in vivo. {ECO:0000269|PubMed:16236768, ECO:0000269|PubMed:8893002}. | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Retards growth rate and reduces organ number in the dorsal region of flowers (By similarity). {ECO:0000250}. | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Retards growth rate and reduces organ number in the dorsal region of flowers (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400006021 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975442 | 1e-168 | HG975442.1 Solanum pennellii chromosome ch03, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015069311.1 | 3e-83 | transcription factor CYCLOIDEA-like | ||||
Swissprot | O49250 | 8e-30 | CYCLD_ANTMA; Transcription factor CYCLOIDEA | ||||
Swissprot | Q9SBV6 | 5e-30 | CYCLD_ANTLN; Transcription factor CYCLOIDEA (Fragment) | ||||
Swissprot | Q9SBV9 | 5e-30 | CYCLD_ANTMH; Transcription factor CYCLOIDEA (Fragment) | ||||
TrEMBL | M0ZUX3 | 1e-113 | M0ZUX3_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400008673 | 1e-114 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA4333 | 22 | 44 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G68800.1 | 9e-24 | TCP domain protein 12 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400006021 |