![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Spipo4G0055700 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
Family | CAMTA | ||||||||
Protein Properties | Length: 109aa MW: 12644.4 Da PI: 9.8688 | ||||||||
Description | CAMTA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CG-1 | 136.3 | 1e-42 | 14 | 109 | 4 | 99 |
CG-1 4 ekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrc 98 k+rwlk++e+++iL+n+++ ++ e+++rp+ gsl+L+nr+++r+frkDG+ w++kkdg+t+ E+he+LKv++v +l+cyYah+eenp fqrr+ Spipo4G0055700 14 AKSRWLKPSEVLSILINHDENLISPEPPNRPPGGSLFLFNRRVLRFFRKDGHVWRRKKDGRTIGEAHEQLKVENVPALSCYYAHGEENPCFQRRS 108 589*******************************************************************************************9 PP CG-1 99 y 99 y Spipo4G0055700 109 Y 109 9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51437 | 62.754 | 7 | 109 | IPR005559 | CG-1 DNA-binding domain |
SMART | SM01076 | 1.2E-46 | 10 | 109 | IPR005559 | CG-1 DNA-binding domain |
Pfam | PF03859 | 9.2E-39 | 14 | 109 | IPR005559 | CG-1 DNA-binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 109 aa Download sequence Send to blast |
QIPGFDIGNL YPAAKSRWLK PSEVLSILIN HDENLISPEP PNRPPGGSLF LFNRRVLRFF 60 RKDGHVWRRK KDGRTIGEAH EQLKVENVPA LSCYYAHGEE NPCFQRRSY |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in freezing tolerance in association with CAMTA1 and CAMTA3. Contributes together with CAMTA1 and CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:23581962). Involved together with CAMTA3 and CAMTA4 in the positive regulation of a general stress response (PubMed:25039701). Involved in tolerance to aluminum. Binds to the promoter of ALMT1 transporter and contributes to the positive regulation of aluminum-induced expression of ALMT1 (PubMed:25627216). {ECO:0000250|UniProtKB:Q8GSA7, ECO:0000269|PubMed:23581962, ECO:0000269|PubMed:25039701, ECO:0000269|PubMed:25627216, ECO:0000305|PubMed:11925432}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salt, wounding, abscisic acid, H(2)O(2) and salicylic acid (PubMed:12218065). Induced by aluminum (PubMed:25627216). {ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:25627216}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010239809.1 | 4e-50 | calmodulin-binding transcription activator 4 isoform X1 | ||||
Swissprot | Q6NPP4 | 1e-42 | CMTA2_ARATH; Calmodulin-binding transcription activator 2 | ||||
TrEMBL | A0A1D1YWA6 | 6e-51 | A0A1D1YWA6_9ARAE; Calmodulin-binding transcription activator 4 | ||||
TrEMBL | A0A1D1ZH88 | 4e-51 | A0A1D1ZH88_9ARAE; Calmodulin-binding transcription activator 4 (Fragment) | ||||
STRING | BRADI5G08167.1 | 1e-48 | (Brachypodium distachyon) | ||||
STRING | AET04958 | 1e-48 | (Medicago truncatula) | ||||
STRING | TRIUR3_26386-P1 | 2e-48 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP15485 | 8 | 17 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64220.2 | 6e-34 | Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains |
Link Out ? help Back to Top | |
---|---|
Phytozome | Spipo4G0055700 |
Publications ? help Back to Top | |||
---|---|---|---|
|