![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc09g007500.2.1 | ||||||||
Common Name | LOC101251808 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 81aa MW: 8975.76 Da PI: 10.4028 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 135.7 | 1.1e-42 | 14 | 80 | 4 | 70 |
S1FA 4 akveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 + ve+kG+nPGlivl+vvgglll+flvgny+ly+yaqk+lPP+kkkPvskkk+k+e+lkqGv++PGe Solyc09g007500.2.1 14 KDVEVKGFNPGLIVLIVVGGLLLTFLVGNYLLYMYAQKTLPPKKKKPVSKKKMKKERLKQGVSAPGE 80 679***************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD019013 | 0.008 | 15 | 80 | No hit | No description |
Pfam | PF04689 | 3.9E-41 | 16 | 80 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 81 aa Download sequence Send to blast |
MDFEDHDNVK NMAKDVEVKG FNPGLIVLIV VGGLLLTFLV GNYLLYMYAQ KTLPPKKKKP 60 VSKKKMKKER LKQGVSAPGE * |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Les.19743 | 1e-136 | flower| fruit| root| seed |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc09g007500.2.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC232935 | 1e-119 | Solanum lycopersicum chromosome 9 clone C09HBa0067J16, complete sequence |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004246674.1 | 6e-51 | DNA-binding protein S1FA | ||||
Refseq | XP_015086281.1 | 6e-51 | DNA-binding protein S1FA-like | ||||
Swissprot | Q42337 | 5e-16 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
TrEMBL | A0A3Q7ISD5 | 1e-49 | A0A3Q7ISD5_SOLLC; Uncharacterized protein | ||||
STRING | Solyc09g007500.2.1 | 2e-50 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3174 | 22 | 49 | Representative plant | OGRP5095 | 13 | 22 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc09g007500.2.1 |
Entrez Gene | 101251808 |
Publications ? help Back to Top | |||
---|---|---|---|
|