PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Seita.3G280400.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 196aa MW: 21217.4 Da PI: 10.9132 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 65.3 | 6.4e-21 | 22 | 66 | 3 | 47 |
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47 ie+ +r vtfskR+ g+lKKA+ELS LC+a+va i+fs+ gk + Seita.3G280400.1.p 22 IEDPARRMVTFSKRKSGLLKKASELSLLCGARVAAIVFSQAGKPF 66 999**************************************9865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 25.623 | 12 | 72 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 6.4E-30 | 12 | 71 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.84E-25 | 13 | 81 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-19 | 14 | 34 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.3E-23 | 22 | 68 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-19 | 34 | 49 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-19 | 49 | 70 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 196 aa Download sequence Send to blast |
MVAPRGTGRT SQGRRRIEIA YIEDPARRMV TFSKRKSGLL KKASELSLLC GARVAAIVFS 60 QAGKPFAFGS PSVDHVLRLC APLPAGDKDE DSLGIGFTGD AIGGGDREVV EATARRKEAA 120 TARVAEEAAR MSYIGKKVLR AAAGRFWWEA DVEALGAEEL REFARALRRL RDNVRRRADK 180 LPLAPVSQPT TTLLQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 4e-16 | 13 | 77 | 1 | 65 | Myocyte-specific enhancer factor 2A |
3kov_B | 4e-16 | 13 | 77 | 1 | 65 | Myocyte-specific enhancer factor 2A |
3kov_I | 4e-16 | 13 | 77 | 1 | 65 | Myocyte-specific enhancer factor 2A |
3kov_J | 4e-16 | 13 | 77 | 1 | 65 | Myocyte-specific enhancer factor 2A |
3mu6_A | 3e-16 | 13 | 77 | 1 | 65 | Myocyte-specific enhancer factor 2A |
3mu6_B | 3e-16 | 13 | 77 | 1 | 65 | Myocyte-specific enhancer factor 2A |
3mu6_C | 3e-16 | 13 | 77 | 1 | 65 | Myocyte-specific enhancer factor 2A |
3mu6_D | 3e-16 | 13 | 77 | 1 | 65 | Myocyte-specific enhancer factor 2A |
3p57_A | 4e-16 | 13 | 77 | 1 | 65 | Myocyte-specific enhancer factor 2A |
3p57_B | 4e-16 | 13 | 77 | 1 | 65 | Myocyte-specific enhancer factor 2A |
3p57_C | 4e-16 | 13 | 77 | 1 | 65 | Myocyte-specific enhancer factor 2A |
3p57_D | 4e-16 | 13 | 77 | 1 | 65 | Myocyte-specific enhancer factor 2A |
3p57_I | 4e-16 | 13 | 77 | 1 | 65 | Myocyte-specific enhancer factor 2A |
3p57_J | 4e-16 | 13 | 77 | 1 | 65 | Myocyte-specific enhancer factor 2A |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Seita.3G280400.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004962402.1 | 1e-137 | agamous-like MADS-box protein AGL29 | ||||
TrEMBL | A0A368QJN0 | 1e-135 | A0A368QJN0_SETIT; Uncharacterized protein | ||||
STRING | Si023118m | 1e-119 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2833 | 30 | 88 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G51870.2 | 8e-18 | AGAMOUS-like 71 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Seita.3G280400.1.p |