PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0123s0052.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family SBP
Protein Properties Length: 1148aa    MW: 126553 Da    PI: 6.4519
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0123s0052.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP115.82.3e-36304378175
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS
                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75 
                           +CqvegC+adls+ak+yhrrh vCe+hska +v+++g+ qrfCqqCsrfh lsefD++krsCrrrLa h++  +k
  Sphfalx0123s0052.1.p 304 MCQVEGCNADLSTAKHYHRRHNVCEFHSKARNVVAHGHVQRFCQQCSRFHVLSEFDDGKRSCRRRLAYHDALWHK 378
                           6********************************************************************976555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF059111.2E-50100251IPR008587Filament-like plant protein
Gene3DG3DSA:4.10.1100.102.3E-34297366IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.308302379IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.84E-34303383IPR004333Transcription factor, SBP-box
PfamPF031101.8E-27305373IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1148 aa     Download sequence    Send to blast
MEKEKESSRL SWPWKKKSSN KAAAAAVTTS LASAGGVGGA SPNLASLFQD NNQQETSVKK  60
LQNHTRAAAA DEATRLRQSE EKVKYISEQL ANALADITAK DNLVKQHAKV AEEAVSGWEK  120
AELEAMALKQ QLDTALHQKL VMEDRAAHLD GALKECMKQL RHAHEEHEQL MHDTLVKKTR  180
EYDKLRVEME TKLAEASHLL SQTRTELLES RAEGKALSHA LQERSRSLAE LGEAKGRAEA  240
DIKVLQCALT KTSHATTVVA QDNAQSYTER ATVATQDKAR SYTEQVSGGR LEESAGSPGS  300
QVPMCQVEGC NADLSTAKHY HRRHNVCEFH SKARNVVAHG HVQRFCQQCS RFHVLSEFDD  360
GKRSCRRRLA YHDALWHKPM PSALTCDAAV ECIGMKGEED SDLSGSPASD SKSMLLHPKN  420
CGSLSLVSLD DSDEQPASAK NNLQLSTPAA TFGRVPKEDQ HSSQPGMQQT SSQPRGLERT  480
IWRNFHDSET TSVAPVSVED VRKAELSTKD KVGFVTRKAK RAARTALAHT AFGQAYEERY  540
LQEKDQHQET SGLESPSYSR IGFPSPARVT DGHLKQENQL STIGIGDTSE NCFQTLLPEM  600
KNDSIFTMGR KGKFEGADSI EFLFKQAEDM SKVVGVGLQW SKVVVTKQFG VVVQHIGEHF  660
WSDLWKETSF SPMRIPIPKP PTKLSMFNLT PETSSKRFGV GLVGSKLENN RVYVEDNQNQ  720
TGEMFPFIFE LAEKMGLSKN AKDSNFQHPS GISSEAVEGE KNDHGGPLLE TMEGGGETDQ  780
GGTSSEPMDL MEVGESSQGG NSGEPMEGVV SGQGGPSSGP TEVGGQRDQQ SSDFQLRFES  840
LQAKGPQDSN ENKSLTVIVI PEVGGTFYEG LSNRQVQPDC RIKGAAIAPW FKFKFEILGG  900
ERKITTTTET RCDLGGAQLT LHEDWDLGYC HDNITISLTC EDPQAVRVSP GIVVAMDVMK  960
RAMTETFTGS MSRANQLASQ ANVQVQMPMV PIGIQAQGTL EVTDTIADSH ALAVTVETSN  1020
TQFSGFNVNQ LECSGSLVFN FLYPEEIVDV KGRGKRQFIH AGINKTLWPT IVGKWFPLDR  1080
EEARLYIFKT NRDIHSIGSL MRFMHQRYEV PFVINHAMSH IHYYEDKELR GAGVKSVDRV  1140
LTKYPEV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-25294373279squamosa promoter binding protein-like 4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.11e-33squamosa promoter binding protein-like 8