PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0001s0120.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family SBP
Protein Properties Length: 822aa    MW: 86354.5 Da    PI: 6.8578
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0001s0120.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.72.2e-40367444178
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                           +CqvegC++dl+ ak+yhrrhkvCe+hskap +++ g+eqrfCqqCsrfh l+efD +krsCrrrLa+hn+rrrk+++
  Sphfalx0001s0120.1.p 367 CCQVEGCKTDLTPAKDYHRRHKVCEMHSKAPRCIAGGQEQRFCQQCSRFHVLTEFDGGKRSCRRRLAGHNRRRRKAHP 444
                           6**************************************************************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-34362429IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.462365442IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.35E-37366446IPR004333Transcription factor, SBP-box
PfamPF031107.4E-31368441IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 822 aa     Download sequence    Send to blast
MDGSSLVKET LENTTSAAFS AISSSPPPEE VQEEVISGQC SHHPLVQFCE LDMAMAAADG  60
TFEQASIVNG GGDNCRSTTA WGEHQSLPTE DSGSMEGSGG GGDYSSTAAA TAAVRMEWDL  120
KTTNPCWEWE NITTMVYPVR QGGGDGEEDS RHVVTKLQAF DWAHVVCSSN VGSSVTTTSS  180
SSPLALKSSD VSMGLASSGT STPSGVSSVS SGVPGLAMNR GNAASHNTEL SSVIKSETVE  240
LTTASRRTPE SPIEHQQRPF VGFLGVQSCE HGEPENSASE NGGEDKKLLD GNQSAAAPSS  300
KQKGAFTGLK LGRQTYFKDS AAGVTAAGGV VQVVRERAAA SAGPICSPPP GKKRQQARSP  360
GGIQIPCCQV EGCKTDLTPA KDYHRRHKVC EMHSKAPRCI AGGQEQRFCQ QCSRFHVLTE  420
FDGGKRSCRR RLAGHNRRRR KAHPETHTTL SIKGLSPVPS DNSLTMEDNK QSIFLQHHRG  480
STSSSTSVDT NEYAGPLANS LKLSPWSGLG RSDDCKLAAS VESQSILSTL LRPTADHLLM  540
LSQSPKGRIA APKSSAPEMA ISPHQFMEGA LSPLGQGLSL SSSSAGLLGG FEPIHLGACS  600
QGAYSVSAVD SGCALSLLSS QAWVSHSSSC PPIQGIPLGL PQADTTLEQF MAGSNDSNYH  660
GPSFSHHSQL QPLGRSQTAQ QQQHCSVVEK LLPLYSRGLG SMETNYGHAG SGNQTIESNV  720
NNDGGQQHNN FLSGLGVYAG AHSMHTLLQT RHFGGLSSGT KANAHPTMDL MQALSTQVQS  780
LTNGSQGGGH SQSQPSSNGH NGEFSPLHPF RGSMYSSQQM L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-28359441284squamosa promoter binding protein-like 4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.32e-27squamosa promoter binding protein-like 2