PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_12193.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | DBB | ||||||||
Protein Properties | Length: 80aa MW: 9092.26 Da PI: 6.205 | ||||||||
Description | DBB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-B_box | 19.6 | 1.9e-06 | 5 | 38 | 2 | 35 |
zf-B_box 2 eerkCpeHeekelqlfCedCqqllCedClleeHk 35 e + C+ ++e e+ lfC+ + lC C ++ H Rsa1.0_12193.1_g00001.1 5 ERHHCDFCGEREAVLFCRADTAKLCLPCDQHVHT 38 6789******99******************9994 PP | |||||||
2 | zf-B_box | 25.8 | 2.2e-08 | 49 | 76 | 3 | 30 |
zf-B_box 3 erkCpeHeekelqlfCedCqqllCedCl 30 ++C+++++++++ C++++ lC+dC Rsa1.0_12193.1_g00001.1 49 SQICDNCGNEPVSVRCFTDNLVLCQDCD 76 689************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00336 | 3.0E-11 | 4 | 51 | IPR000315 | B-box-type zinc finger |
PROSITE profile | PS50119 | 9.471 | 4 | 51 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 2.30E-5 | 8 | 39 | No hit | No description |
PROSITE profile | PS50119 | 9.2 | 47 | 80 | IPR000315 | B-box-type zinc finger |
Pfam | PF00643 | 3.0E-6 | 49 | 80 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 1.97E-5 | 51 | 80 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005622 | Cellular Component | intracellular | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 80 aa Download sequence Send to blast |
MSSSERHHCD FCGEREAVLF CRADTAKLCL PCDQHVHTAN LLSKKHVRSQ ICDNCGNEPV 60 SVRCFTDNLV LCQDCDWDVH |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_12193.1_g00001.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018461608.1 | 4e-53 | PREDICTED: zinc finger protein CONSTANS-LIKE 15-like | ||||
Swissprot | Q9C7E8 | 4e-48 | COL15_ARATH; Zinc finger protein CONSTANS-LIKE 15 | ||||
TrEMBL | A0A078FRD4 | 8e-50 | A0A078FRD4_BRANA; BnaA07g08670D protein | ||||
TrEMBL | A0A078JIT7 | 7e-49 | A0A078JIT7_BRANA; BnaCnng51750D protein | ||||
TrEMBL | A0A0D3D6C5 | 7e-49 | A0A0D3D6C5_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6BHM5 | 1e-49 | A0A3P6BHM5_BRACM; Uncharacterized protein | ||||
TrEMBL | A0A3P6EA85 | 6e-49 | A0A3P6EA85_BRAOL; Uncharacterized protein | ||||
TrEMBL | M4EMQ0 | 2e-49 | M4EMQ0_BRARP; Uncharacterized protein | ||||
STRING | Bra030070.1-P | 3e-50 | (Brassica rapa) | ||||
STRING | Bo7g048510.1 | 1e-49 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3871 | 26 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G28050.1 | 2e-50 | B-box type zinc finger protein with CCT domain |
Publications ? help Back to Top | |||
---|---|---|---|
|