PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_02075.1_g00003.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | Trihelix | ||||||||
Protein Properties | Length: 117aa MW: 13834.9 Da PI: 9.7351 | ||||||||
Description | Trihelix family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | trihelix | 68 | 1.9e-21 | 44 | 107 | 1 | 64 |
trihelix 1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykki 64 +W+ +e ++Li++r e+++++ ++k++k lWe vs+kmr++ f rsp+qCk+kw+nl +r+k + Rsa1.0_02075.1_g00003.1 44 QWSLEESKELIAIRGELDQTFMETKRNKLLWEVVSNKMRDKSFLRSPEQCKCKWKNLVTRFKLE 107 7************************************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 0.0061 | 41 | 103 | IPR001005 | SANT/Myb domain |
CDD | cd12203 | 1.78E-25 | 43 | 105 | No hit | No description |
Pfam | PF13837 | 4.8E-16 | 44 | 107 | No hit | No description |
PROSITE profile | PS50090 | 7.596 | 45 | 101 | IPR017877 | Myb-like domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
MAGHQHQLHH LQFLNKHHHH VHPQSQTPEI ASPATVAAGD RFPQWSLEES KELIAIRGEL 60 DQTFMETKRN KLLWEVVSNK MRDKSFLRSP EQCKCKWKNL VTRFKLEVVH ETMLYTK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2ebi_A | 1e-13 | 41 | 105 | 3 | 67 | DNA binding protein GT-1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may play a role in the induction of CAM4 in response to pathogen and salt. {ECO:0000269|PubMed:15310827}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_02075.1_g00003.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salt and infection with the bacterial pathogen P.syringae pv tomato. {ECO:0000269|PubMed:15310827}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC003028 | 7e-82 | AC003028.3 Arabidopsis thaliana chromosome 2 clone F16M14 map ve018, complete sequence. | |||
GenBank | AF453582 | 7e-82 | AF453582.1 Arabidopsis thaliana GT-1 like transcription factor (GT1L) mRNA, complete cds. | |||
GenBank | AY271678 | 7e-82 | AY271678.1 Arabidopsis thaliana transcription factor GT-3b (GT3B) mRNA, complete cds. | |||
GenBank | CP002685 | 7e-82 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009133240.1 | 9e-70 | PREDICTED: trihelix transcription factor GT-3b-like | ||||
Refseq | XP_013740623.1 | 9e-70 | trihelix transcription factor GT-3b-like | ||||
Swissprot | O80450 | 1e-50 | TGT3B_ARATH; Trihelix transcription factor GT-3b | ||||
TrEMBL | M4C768 | 2e-68 | M4C768_BRARP; Uncharacterized protein | ||||
STRING | Bra000046.1-P | 3e-69 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2215 | 28 | 70 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38250.1 | 7e-49 | Trihelix family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|