![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC9579_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 96aa MW: 10524.4 Da PI: 10.4877 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 84.5 | 6.4e-27 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien rqvtf+kRr+g+lKKA+ELSvLCdae+ v+ifs++gkl+e + RrC9579_p1 9 KRIENPVHRQVTFCKRRTGLLKKAKELSVLCDAEIGVVIFSPQGKLFELA 58 79********************************************9965 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.885 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 8.0E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 7.59E-30 | 1 | 76 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.41E-40 | 2 | 78 | No hit | No description |
PRINTS | PR00404 | 3.5E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.3E-25 | 10 | 56 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.5E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.5E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 96 aa Download sequence Send to blast |
MARGKIQLKR IENPVHRQVT FCKRRTGLLK KAKELSVLCD AEIGVVIFSP QGKLFELATK 60 GTMDGIIDKY MKCTGGGRGS SSAIFTAQEQ LQPANL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6bz1_A | 6e-19 | 1 | 84 | 1 | 83 | MEF2 CHIMERA |
6bz1_B | 6e-19 | 1 | 84 | 1 | 83 | MEF2 CHIMERA |
6bz1_C | 6e-19 | 1 | 84 | 1 | 83 | MEF2 CHIMERA |
6bz1_D | 6e-19 | 1 | 84 | 1 | 83 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269|PubMed:18203871}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin in root phloem. {ECO:0000269|PubMed:18203871}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC984302 | 1e-131 | KC984302.2 Brassica oleracea var. viridis AGL12 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018468908.1 | 3e-65 | PREDICTED: agamous-like MADS-box protein AGL12 | ||||
Swissprot | Q38841 | 2e-63 | AGL12_ARATH; Agamous-like MADS-box protein AGL12 | ||||
TrEMBL | A0A398AAJ7 | 6e-63 | A0A398AAJ7_BRACM; Uncharacterized protein | ||||
TrEMBL | M4CUS7 | 6e-63 | M4CUS7_BRARP; Uncharacterized protein | ||||
STRING | Bra007972.1-P | 1e-63 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7052 | 26 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71692.1 | 9e-66 | AGAMOUS-like 12 |
Publications ? help Back to Top | |||
---|---|---|---|
|