![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC10044_p2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | Trihelix | ||||||||
Protein Properties | Length: 113aa MW: 13055 Da PI: 9.9481 | ||||||||
Description | Trihelix family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | trihelix | 68.5 | 1.3e-21 | 46 | 109 | 1 | 64 |
trihelix 1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykki 64 +W+ +e+++ + +r+e+++++ ++k+ k lWe v++km+++gf rs++qCk+kw+nl rykk RrC10044_p2 46 QWSIDETKEFLGIREELDQTFMEAKRTKLLWEVVAAKMADKGFARSAEQCKSKWKNLVARYKKY 109 7*************************************************************95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
CDD | cd12203 | 1.24E-21 | 45 | 108 | No hit | No description |
Pfam | PF13837 | 4.1E-17 | 46 | 109 | No hit | No description |
PROSITE profile | PS50090 | 7.538 | 47 | 103 | IPR017877 | Myb-like domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 113 aa Download sequence Send to blast |
MDRRNPFHHH HQLHHLIQQQ QLPPPPQSTT VAMDLGGGGG GERIPQWSID ETKEFLGIRE 60 ELDQTFMEAK RTKLLWEVVA AKMADKGFAR SAEQCKSKWK NLVARYKKYA ISF |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that binds specifically to the core DNA sequence 5'-GTTAC-3'. {ECO:0000269|PubMed:15044016}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC240935 | 1e-131 | AC240935.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrF042C17, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009130657.1 | 2e-52 | PREDICTED: trihelix transcription factor GT-3a-like | ||||
Refseq | XP_013740024.1 | 2e-52 | trihelix transcription factor GT-3a | ||||
Swissprot | Q9SDW0 | 2e-38 | TGT3A_ARATH; Trihelix transcription factor GT-3a | ||||
TrEMBL | A0A397ZQE1 | 1e-52 | A0A397ZQE1_BRACM; Uncharacterized protein | ||||
STRING | Bo3g001460.1 | 3e-51 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2215 | 28 | 70 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G01380.1 | 2e-40 | Trihelix family protein |