PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00301g04022.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family MYB
Protein Properties Length: 541aa    MW: 59748.9 Da    PI: 8.3134
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00301g04022.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.63.7e-1560106148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
           Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                               +g WT+eEd  l +av+ + g++Wk+Ia+ +   R++ qc +rwqk+l
  Peinf101Scf00301g04022.1  60 KGGWTPEEDNTLRRAVATYRGKSWKKIAEFFT-DRSEVQCLHRWQKVL 106
                               688****************************9.************986 PP

2Myb_DNA-binding58.91.1e-18112158148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
           Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                               +g+WT+eEd++++++v+++G+  W+ Ia+ ++ gR +kqc++rw+++l
  Peinf101Scf00301g04022.1 112 KGPWTQEEDDKIIELVAKYGPIKWSVIAKALP-GRIGKQCRERWHNHL 158
                               79******************99**********.*************97 PP

3Myb_DNA-binding56.37.4e-18164207146
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
           Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                               +++WT eE++ lv+a++ +G++ W+ Ia+ ++ gRt++++k++w++
  Peinf101Scf00301g04022.1 164 KDAWTLEEELALVNAHRVYGNK-WAEIAKVLP-GRTDNSIKNHWNS 207
                               679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.55955106IPR017930Myb domain
SMARTSM007171.0E-1359108IPR001005SANT/Myb domain
PfamPF002491.3E-1460106IPR001005SANT/Myb domain
SuperFamilySSF466891.22E-1461116IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-1962112IPR009057Homeodomain-like
CDDcd001677.12E-1263106No hitNo description
PROSITE profilePS5129432.285107162IPR017930Myb domain
SMARTSM007175.3E-19111160IPR001005SANT/Myb domain
SuperFamilySSF466893.67E-31112210IPR009057Homeodomain-like
PfamPF002497.0E-18112158IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-27113161IPR009057Homeodomain-like
CDDcd001674.05E-16114158No hitNo description
Gene3DG3DSA:1.10.10.605.2E-23162213IPR009057Homeodomain-like
PROSITE profilePS5129422.612163213IPR017930Myb domain
SMARTSM007178.6E-17163211IPR001005SANT/Myb domain
PfamPF002499.7E-16164207IPR001005SANT/Myb domain
CDDcd001671.10E-12166209No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 541 aa     Download sequence    Send to blast
MDELMKLEGC CTENKQSTAA MSSSVSENSG SLTVKSLEVC SPTPTSSAHR RATGPIRRAK  60
GGWTPEEDNT LRRAVATYRG KSWKKIAEFF TDRSEVQCLH RWQKVLNPEL VKGPWTQEED  120
DKIIELVAKY GPIKWSVIAK ALPGRIGKQC RERWHNHLNP NIRKDAWTLE EELALVNAHR  180
VYGNKWAEIA KVLPGRTDNS IKNHWNSSLK KKLDFYLATG NLPPVARDVL QNGCKDTVKT  240
ASAEKALVCS HKGSDSTEVA SSGTTDVCRI ENGDKNHQDT KLLVANIGAS ISGPQNGSDS  300
EVVRWEAESP VIDTIHVKPI TQIRFEGYGI NSEVDQFKVI ETPFSCEIPT CGTLYYEPPQ  360
LGSCISVDSD HLNIRSRLCE SDASPSLSPS SFSTPSSLKG SSLYAQTPES ILKIAARSFP  420
NTPSIFRKRK LSSTSSNKIG NADGDTSKDE VHDACEEKQT DSSEKYGMHR ESSSRNPSYN  480
GIGPCNTKAF NASPPYRLRS KRKSIFKSVE KRLKFAFDNE QPDSTGISDS AVKETSDVAK  540
D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C9e-67592135159MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-67592135159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1500513KRKSIFKSVEKRLK
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds 5'-AACGG-3' motifs in gene promoters (By similarity). Transcription repressor that regulates organ growth. Binds to the promoters of G2/M-specific genes and to E2F target genes to prevent their expression in post-mitotic cells and to restrict the time window of their expression in proliferating cells (PubMed:26069325). {ECO:0000250|UniProtKB:Q94FL9, ECO:0000269|PubMed:26069325}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Slightly induced by ethylene and salicylic acid (SA). {ECO:0000269|PubMed:16463103}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754487e-33HG975448.1 Solanum pennellii chromosome ch09, complete genome.
GenBankHG9755217e-33HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016464213.10.0PREDICTED: uncharacterized protein LOC107787190 isoform X1
SwissprotQ6R0321e-152MB3R5_ARATH; Transcription factor MYB3R-5
TrEMBLA0A1S3ZIQ20.0A0A1S3ZIQ2_TOBAC; uncharacterized protein LOC107787190 isoform X1
STRINGXP_009787902.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54612437
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-152myb domain protein 3r-5
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Kobayashi K, et al.
    Transcriptional repression by MYB3R proteins regulates plant organ growth.
    EMBO J., 2015. 34(15): p. 1992-2007
    [PMID:26069325]
  3. Chen P, et al.
    Arabidopsis R1R2R3-Myb proteins are essential for inhibiting cell division in response to DNA damage.
    Nat Commun, 2017. 8(1): p. 635
    [PMID:28935922]