![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pbr029986.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 163aa MW: 17873.7 Da PI: 9.0213 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 128.3 | 1.1e-39 | 13 | 156 | 4 | 161 |
YABBY 4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvssekl 101 ++ se++Cyv+CnfCnt+lav +P + l+ ++tv+CGhC++l l++ s l+ + ++ l + ++ + ++s+s+ ++ Pbr029986.1 13 NQPSENLCYVRCNFCNTVLAVGLPCKRLMDTITVKCGHCSNLSF---------LSTRSPLEGQCLPDHPTSLTLQAGCCTDFRKGQSSSSSLSPV--- 98 5789************************************9754.........444455556666666666666666666555555444444444... PP YABBY 102 senedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWa 161 +++ +p++p v++PPek+ r Psaynrf+k+ei+rika+nP++ hreafsaaakn Pbr029986.1 99 --SSNPPSPKAPFVVKPPEKKHRLPSAYNRFMKDEIKRIKATNPEVPHREAFSAAAKNKV 156 ..5567899999**********************************************75 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 1.1E-49 | 15 | 155 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 3.67E-7 | 100 | 152 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010254 | Biological Process | nectary development | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0048479 | Biological Process | style development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 163 aa Download sequence Send to blast |
MSMEEKVTMD FINQPSENLC YVRCNFCNTV LAVGLPCKRL MDTITVKCGH CSNLSFLSTR 60 SPLEGQCLPD HPTSLTLQAG CCTDFRKGQS SSSSLSPVSS NPPSPKAPFV VKPPEKKHRL 120 PSAYNRFMKD EIKRIKATNP EVPHREAFSA AAKNKVGFNL PL* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Regulates carpel specification in flower development. Severe or intermediate mutation in DL causes complete or partial homeotic conversion of carpels into stamens without affecting the identities of other floral organs. Interacts antagonistically with class B genes and controls floral meristem determinacy. Regulates midrib formation in leaves probably by inducing cell proliferation in the central region of the leaf. {ECO:0000269|PubMed:14729915}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00220 | DAP | Transfer from AT1G69180 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pbr029986.1 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB627250 | 1e-130 | AB627250.1 Malus x domestica mRNA, microsatellite: MEST098, clone: FLW01_10_E08. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008389395.1 | 3e-96 | protein CRABS CLAW isoform X4 | ||||
Swissprot | Q76EJ0 | 4e-59 | YABDL_ORYSJ; Protein DROOPING LEAF | ||||
TrEMBL | A0A498IBD4 | 1e-90 | A0A498IBD4_MALDO; Uncharacterized protein | ||||
STRING | XP_009356541.1 | 1e-109 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF10259 | 30 | 40 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69180.1 | 3e-56 | YABBY family protein |