PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100263070031
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family bZIP
Protein Properties Length: 263aa    MW: 29312.5 Da    PI: 6.1676
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100263070031genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.11.4e-11180228553
                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                                   kr +r   NR +A+rsR RK+++i eLe+ v +L+ae + L  ++  l 
  Ote100263070031|100263070031 180 KRIKRILANRQSAQRSRVRKLQYISELERSVSSLQAEVSVLSPRVAYLD 228
                                   99***********************************988877766655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.9E-14176240IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.76178230IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.21E-11180234No hitNo description
PfamPF001706.1E-10180225IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.4E-13180231No hitNo description
CDDcd147037.62E-25181231No hitNo description
PROSITE patternPS000360183198IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MAQLPPKVPT ITPNWPDFSY QKMEALSINH HSSSTTPSWV DEFXXXXXXX XXSARRGSHR  60
RSMSDSVAFL EQPMVEECRS MRHSSITAAP AGGDFERFDD EQLMSMFDDG GGVGPCSNPS  120
SPSDHNSINE DEKQGPSSDP PNPVGLLPLV QQPKSEPEED DSSCKSDGIN GSGEKIADPK  180
RIKRILANRQ SAQRSRVRKL QYISELERSV SSLQAEVSVL SPRVAYLDHQ RLVLNVDNSV  240
LKQRIAALAQ DKVFKDVIWF RHS
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator. {ECO:0000269|PubMed:17719007}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027172353.11e-107basic leucine zipper 61-like
RefseqXP_027172358.11e-107basic leucine zipper 61-like
SwissprotQ9M2K41e-81BZP61_ARATH; Basic leucine zipper 61
TrEMBLA0A2G9GQ321e-116A0A2G9GQ32_9LAMI; Uncharacterized protein
STRINGSolyc07g053450.2.11e-103(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17752465
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gibalov√° A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  3. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]