PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100139950051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family bZIP
Protein Properties Length: 166aa    MW: 18729.9 Da    PI: 7.347
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100139950051genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.52.2e-1187131549
                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                                   kr +r   NR +A+rsR RK+ +i eLe+ v +L+ae + L  ++
  Ote100139950051|100139950051  87 KRIKRILANRQSAQRSRVRKLHYISELERSVSSLQAEVSVLSPRV 131
                                   99***********************************88777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.0E-1383147IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.48485137IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.77E-1187141No hitNo description
Gene3DG3DSA:1.20.5.1704.7E-1387139No hitNo description
PfamPF001704.9E-1087131IPR004827Basic-leucine zipper domain
CDDcd147031.23E-2388138No hitNo description
PROSITE patternPS00036090105IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MAEDCRTMRH HFHDHHLMSM FNDPGVSCSN PSSPSDHNSI NDDDKQGPSD HPNQMVLPHP  60
KSEPEEDDSS CKSDGINGSG EKISDPKRIK RILANRQSAQ RSRVRKLHYI SELERSVSSL  120
QAEVSVLSPR VAFLDHQRLV LNVDNSVLKQ RIAALAQDKV FKDGKW
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator. {ECO:0000269|PubMed:17719007}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011100223.18e-71basic leucine zipper 61
SwissprotQ9M2K44e-55BZP61_ARATH; Basic leucine zipper 61
TrEMBLA0A2G9GQ324e-75A0A2G9GQ32_9LAMI; Uncharacterized protein
STRINGXP_009629315.11e-63(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17752465
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gibalov√° A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  3. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]