PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ote100081660001

Organism

Ocimum tenuiflorum

Taxonomic ID

204149

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum

Family

MYB_related

Protein Properties

Length: 80aa MW: 9198.45 Da PI: 8.7994

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ote100081660001	genome	OteDB	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	62.6	8.2e-20	12	57	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEde l ++v+++G+++W++I++ ++ gR++k+c++rw + Ote100081660001\|100081660001 12 KGPWSPEEDESLQRLVEKFGPRNWSLISKSIP-GRSGKSCRLRWCNQ 57 79****************************.*********985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.854	7	62	IPR017930	Myb domain
SuperFamily	SSF46689	1.1E-21	8	79	IPR009057	Homeodomain-like
SMART	SM00717	1.7E-16	11	60	IPR001005	SANT/Myb domain
Pfam	PF00249	1.2E-19	12	57	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.6E-23	12	57	IPR009057	Homeodomain-like
CDD	cd00167	3.56E-15	14	56	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.3E-5	58	80	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 80 aa Download sequence Send to blast
MAGHKKEMDR IKGPWSPEED ESLQRLVEKF GPRNWSLISK SIPGRSGKSC RLRWCNQLSP 60 QVEHRAFTPE EDDAIIKAHA

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1mse_C	5e-22	11	79	3	71	C-Myb DNA-Binding Domain
1msf_C	5e-22	11	79	3	71	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269\|PubMed:23809151, ECO:0000269\|PubMed:24894996}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt stress. {ECO:0000269\|PubMed:23809151}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003611666.2	7e-46	transcription factor MYB44
Swissprot	O23160	4e-41	MYB73_ARATH; Transcription factor MYB73
TrEMBL	A0A396HN33	2e-44	A0A396HN33_MEDTR; Putative transcription factor MYB-HB-like family
TrEMBL	B7FK68	3e-45	B7FK68_MEDTR; Uncharacterized protein
TrEMBL	I3T3V2	2e-44	I3T3V2_MEDTR; Uncharacterized protein
STRING	XP_008360495.1	3e-45	(Malus domestica)
STRING	EMJ06721	8e-45	(Prunus persica)
STRING	XP_007155887.1	4e-45	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1586	24	71

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]