![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LOC_Os04g41560.4 | ||||||||
Common Name | LOC4336260, OJ990528_30.8, Os04g0493000, OSJNBb0091E11.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | DBB | ||||||||
Protein Properties | Length: 182aa MW: 18937.5 Da PI: 5.5767 | ||||||||
Description | DBB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-B_box | 23.5 | 1.1e-07 | 4 | 46 | 5 | 41 |
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 C+ +e ++ C ++ lC+ C +e+H H++ p LOC_Os04g41560.4 4 QCDACEAAAATVVCCADEAALCARCDVEIHAAnklaskHQRLP 46 6******99*********************6678888898877 PP | |||||||
2 | zf-B_box | 27.5 | 6.6e-09 | 55 | 86 | 3 | 34 |
zf-B_box 3 erkCpeHeekelqlfCedCqqllCedClleeH 34 ++C+ ++ek + +fC +++ l+C+dC + +H LOC_Os04g41560.4 55 LPRCDVCQEKAAFIFCVEDRALFCRDCDEPIH 86 589**************************999 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50119 | 10.096 | 1 | 47 | IPR000315 | B-box-type zinc finger |
SMART | SM00336 | 4.6E-9 | 4 | 47 | IPR000315 | B-box-type zinc finger |
Pfam | PF00643 | 1.7E-5 | 4 | 47 | IPR000315 | B-box-type zinc finger |
SMART | SM00336 | 5.0E-14 | 53 | 100 | IPR000315 | B-box-type zinc finger |
PROSITE profile | PS50119 | 8.532 | 53 | 100 | IPR000315 | B-box-type zinc finger |
Pfam | PF00643 | 1.5E-6 | 56 | 96 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 7.75E-7 | 56 | 86 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009640 | Biological Process | photomorphogenesis | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0048573 | Biological Process | photoperiodism, flowering | ||||
GO:0080167 | Biological Process | response to karrikin | ||||
GO:0090351 | Biological Process | seedling development | ||||
GO:1902448 | Biological Process | positive regulation of shade avoidance | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003712 | Molecular Function | transcription cofactor activity | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0020039 | anatomy | leaf lamina |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 182 aa Download sequence Send to blast |
MRIQCDACEA AAATVVCCAD EAALCARCDV EIHAANKLAS KHQRLPLDAA LPAALPRCDV 60 CQEKAAFIFC VEDRALFCRD CDEPIHVPGT LSGNHQRYLT TGIRVGFSSV CSANADHLPP 120 PAPKGNSKPP ASGIAAAAAP KPAVSAAAQE VPSSPFLPPS GWAVEDLLQL SDYESSDKAR 180 T* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.100063 | 0.0 | callus| flower| leaf| panicle| root| seed| stem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | O82113 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: High expression in leaves and lower in roots and flowers. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Acts as negative regulator of seedling photomorphogenesis and light-regulated inhibition of hypocotyl elongation (PubMed:17605755, PubMed:18540109, PubMed:21685177). BBX24/STO and BBX25/STH function as transcriptional corepressors of HY5 activity, leading to the down-regulation of BBX22 expression. BBX24/STO acts additively with BBX25/STH during de-etiolation and the hypocotyl shade avoidance response (PubMed:23624715). Functions as negative regulator of photomorphogenic UV-B responses by interacting with both COP1 and HY5 (PubMed:22410790). May act as a transcription factor in the salt-stress response (PubMed:12909688). {ECO:0000269|PubMed:12909688, ECO:0000269|PubMed:17605755, ECO:0000269|PubMed:18540109, ECO:0000269|PubMed:21685177, ECO:0000269|PubMed:22410790, ECO:0000269|PubMed:23624715}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LOC_Os04g41560.4 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian regulation with a peak before dawn. {ECO:0000269|PubMed:17605755}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
RiceGE | Os04g41560 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB001883 | 0.0 | AB001883.1 Oryza sativa Japonica Group mRNA for zinc finger protein, complete cds, clone:E10707. | |||
GenBank | HQ324805 | 0.0 | HQ324805.1 Oryza sativa Japonica Group clone KCB761B05 zinc finger protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015636444.1 | 1e-125 | B-box zinc finger protein 24 | ||||
Swissprot | Q96288 | 1e-58 | BBX24_ARATH; B-box zinc finger protein 24 | ||||
TrEMBL | O82113 | 1e-123 | O82113_ORYSJ; OJ990528_30.8 protein | ||||
STRING | ORGLA04G0142700.1 | 1e-123 | (Oryza glaberrima) | ||||
STRING | ORGLA08G0014000.1 | 1e-123 | (Oryza glaberrima) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G06040.2 | 2e-37 | DBB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | LOC_Os04g41560.4 |
Entrez Gene | 4336260 |
Publications ? help Back to Top | |||
---|---|---|---|
|