PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA08G24560.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 216aa    MW: 24819.4 Da    PI: 8.7266
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA08G24560.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.18.4e-32959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  ONIVA08G24560.3  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                     79***********************************************96 PP

2K-box76.85.8e-267014326100
            K-box  26 keienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                      k+++++++  R+llGedL+sL +keL++Le+qL++slk++R++++++l++q+ elq+ke++++e+n++Lr+klee
  ONIVA08G24560.3  70 KQLSKIEK-VRNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMVSEANRCLRRKLEE 143
                      34455555.5**************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.389161IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
CDDcd002652.39E-40265No hitNo description
SuperFamilySSF554556.15E-31279IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-33323IPR002100Transcription factor, MADS-box
PfamPF003191.8E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-333859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.7155147IPR002487Transcription factor, K-box
PfamPF014865.7E-1977141IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0048481Biological Processplant ovule development
GO:0048833Biological Processspecification of floral organ number
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCST  60
QRNAVTQDPK QLSKIEKVRN LLGEDLDSLG IKELESLEKQ LDSSLKHVRT TRTKHLVDQL  120
TELQRKEQMV SEANRCLRRK LEESNHVRGQ QVWEQGCNLI GYERQPEVQQ PLHGGNGFFH  180
PLDAAGEPTL QIGYPAEHHE AMNSACMNTY MPPWLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A5e-20165165MEF2 CHIMERA
6byy_B5e-20165165MEF2 CHIMERA
6byy_C5e-20165165MEF2 CHIMERA
6byy_D5e-20165165MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor. May be involved in the control of flowering time. {ECO:0000269|PubMed:9339904, ECO:0000269|Ref.10}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00605ChIP-seqTransfer from AT1G24260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1002630.0AK100263.1 Oryza sativa Japonica Group cDNA clone:J023063L04, full insert sequence.
GenBankAY5519210.0AY551921.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS216 mRNA, complete cds.
GenBankFJ7509340.0FJ750934.1 Oryza sativa clone KCS054B01 MADS-box transcription factor 7 mRNA, complete cds.
GenBankOSU319940.0U31994.1 Oryza sativa MADS box protein OsMADS45 mRNA, complete cds.
GenBankOSU788910.0U78891.2 Oryza sativa MADS box protein (MADS7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648762.11e-142MADS-box transcription factor 7
SwissprotP0C5B01e-143MADS7_ORYSI; MADS-box transcription factor 7
SwissprotQ0J4661e-143MADS7_ORYSJ; MADS-box transcription factor 7
TrEMBLA0A0D3H2I31e-160A0A0D3H2I3_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0IF041e-160A0A0E0IF04_ORYNI; Uncharacterized protein
STRINGOS08T0531700-011e-141(Oryza sativa)
STRINGORGLA08G0230000.11e-141(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.15e-66MIKC_MADS family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Shitsukawa N, et al.
    Genetic and epigenetic alteration among three homoeologous genes of a class E MADS box gene in hexaploid wheat.
    Plant Cell, 2007. 19(6): p. 1723-37
    [PMID:17586655]
  3. Bai X,Wang Q,Chu C
    Excision of a selective marker in transgenic rice using a novel Cre/loxP system controlled by a floral specific promoter.
    Transgenic Res., 2008. 17(6): p. 1035-43
    [PMID:18437520]
  4. Qu L, et al.
    Expression pattern and functional analysis of a MADS-box gene M79 from rice.
    Sci. China, C, Life Sci., 2001. 44(2): p. 161-9
    [PMID:18726433]
  5. Cui R, et al.
    Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa).
    Plant J., 2010. 61(5): p. 767-81
    [PMID:20003164]
  6. Li H, et al.
    The AGL6-like gene OsMADS6 regulates floral organ and meristem identities in rice.
    Cell Res., 2010. 20(3): p. 299-313
    [PMID:20038961]
  7. Seok HY, et al.
    Rice ternary MADS protein complexes containing class B MADS heterodimer.
    Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604
    [PMID:20888318]
  8. Tang X, et al.
    Global gene profiling of laser-captured pollen mother cells indicates molecular pathways and gene subfamilies involved in rice meiosis.
    Plant Physiol., 2010. 154(4): p. 1855-70
    [PMID:20959420]
  9. Wang SS,Wang CS,Tseng TH,Hou YL,Chen KY
    High-resolution genetic mapping and candidate gene identification of the SLP1 locus that controls glume development in rice.
    Theor. Appl. Genet., 2011. 122(8): p. 1489-96
    [PMID:21327937]
  10. Li H, et al.
    Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate.
    Plant Cell, 2011. 23(7): p. 2536-52
    [PMID:21784949]
  11. Yoshida H
    Is the lodicule a petal: molecular evidence?
    Plant Sci., 2012. 184: p. 121-8
    [PMID:22284716]
  12. Duan Y, et al.
    Characterization of Osmads6-5, a null allele, reveals that OsMADS6 is a critical regulator for early flower development in rice (Oryza sativa L.).
    Plant Mol. Biol., 2012. 80(4-5): p. 429-42
    [PMID:22933119]
  13. Wong CE,Singh MB,Bhalla PL
    Novel members of the AGAMOUS LIKE 6 subfamily of MIKCC-type MADS-box genes in soybean.
    BMC Plant Biol., 2013. 13: p. 105
    [PMID:23870482]
  14. Hu Z,Ding X,Hu S,Sun Y,Xia L
    Tissue-specifically regulated site-specific excision of selectable marker genes in bivalent insecticidal, genetically-modified rice.
    Biotechnol. Lett., 2013. 35(12): p. 2177-83
    [PMID:23974493]
  15. Bai X, et al.
    Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice.
    Sci Rep, 2016. 6: p. 19022
    [PMID:26744119]
  16. Dreni L,Zhang D
    Flower development: the evolutionary history and functions of the AGL6 subfamily MADS-box genes.
    J. Exp. Bot., 2016. 67(6): p. 1625-38
    [PMID:26956504]