PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

ONIVA02G08210.1

Organism

Oryza nivara

Taxonomic ID

4536

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

MYB

Protein Properties

Length: 301aa MW: 32322.2 Da PI: 8.6251

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
ONIVA02G08210.1	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	59.7	6.3e-19	11	56	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEde l ++v+++G ++W++I r ++ gR++k+c++rw + ONIVA02G08210.1 11 KGPWSPEEDEALRRLVERHGARNWTAIGRGIP-GRSGKSCRLRWCNQ 56 79****************************.*********985 PP
2	Myb_DNA-binding	54.7	2.3e-17	63	106	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r ++T+eEd +++a+++lG++ W++Iar ++ gRt++ +k++w++ ONIVA02G08210.1 63 RRPFTAEEDAAILRAHARLGNR-WAAIARLLP-GRTDNAVKNHWNS 106 679*****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.481	6	61	IPR017930	Myb domain
SuperFamily	SSF46689	1.72E-31	8	104	IPR009057	Homeodomain-like
SMART	SM00717	9.6E-17	10	59	IPR001005	SANT/Myb domain
Pfam	PF00249	3.9E-18	11	56	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.6E-25	12	64	IPR009057	Homeodomain-like
CDD	cd00167	3.81E-16	13	55	No hit	No description
SMART	SM00717	4.6E-16	62	110	IPR001005	SANT/Myb domain
Pfam	PF00249	3.6E-15	63	106	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	21.395	63	112	IPR017930	Myb domain
CDD	cd00167	7.71E-13	65	108	No hit	No description
Gene3D	G3DSA:1.10.10.60	5.7E-24	65	112	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 301 aa Download sequence Send to blast
MGMEAECDRI KGPWSPEEDE ALRRLVERHG ARNWTAIGRG IPGRSGKSCR LRWCNQLSPQ 60 VERRPFTAEE DAAILRAHAR LGNRWAAIAR LLPGRTDNAV KNHWNSSLKR KLATATDGGE 120 IDRPCKRVSP GPGSPTGSER SELSHGGCGS GSGGGQVFRP VPRPGGFDAI SAADVVRPPR 180 RRDDNDDDGD DDPLTSLSLS LSLPGFHHDS ARSHFQELPS PSRSPSPPPS PPAASPSAYP 240 FNADLVSAMQ EMIRTEVRNY MAGVGLRAGC GPGAVAESFM PQLVDGVMRA AAERVGVVTR 300 Q

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-41	8	114	4	110	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202, ECO:0000269\|PubMed:23603962, ECO:0000269\|PubMed:24894996, ECO:0000269\|PubMed:9678577}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00653	PBM	Transfer from LOC_Os02g09480	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP003990	0.0	AP003990.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1073_F05.
GenBank	AP004046	0.0	AP004046.2 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1145_F01.
GenBank	AP014958	0.0	AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015623498.1	0.0	transcription factor MYB44
Swissprot	Q9FDW1	1e-65	MYB44_ARATH; Transcription factor MYB44
TrEMBL	A0A0D9YNG7	0.0	A0A0D9YNG7_9ORYZ; Uncharacterized protein
TrEMBL	A0A0E0G2Z7	0.0	A0A0E0G2Z7_ORYNI; Uncharacterized protein
TrEMBL	A0A0E0NAY1	0.0	A0A0E0NAY1_ORYRU; Uncharacterized protein
TrEMBL	Q6ZHS5	0.0	Q6ZHS5_ORYSJ; Os02g0187700 protein
STRING	OGLUM02G06640.1	0.0	(Oryza glumipatula)
STRING	ORUFI02G06760.1	0.0	(Oryza rufipogon)
STRING	OS02T0187700-00	0.0	(Oryza sativa)
STRING	ONIVA02G08210.1	0.0	(Oryza nivara)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP789	38	154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G67300.1	6e-67	myb domain protein r1

Publications ? help Back to Top
Li C,Chang PP,Ghebremariam KM,Qin L,Liang Y Overexpression of tomato SpMPK3 gene in Arabidopsis enhances the osmotic tolerance. Biochem. Biophys. Res. Commun., 2014. 443(2): p. 357-62 [PMID:24275141] Jaradat MR,Feurtado JA,Huang D,Lu Y,Cutler AJ Multiple roles of the transcription factor AtMYBR1/AtMYB44 in ABA signaling, stress responses, and leaf senescence. BMC Plant Biol., 2013. 13: p. 192 [PMID:24286353] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Li D, et al. Arabidopsis ABA receptor RCAR1/PYL9 interacts with an R2R3-type MYB transcription factor, AtMYB44. Int J Mol Sci, 2014. 15(5): p. 8473-90 [PMID:24828206] Xu DB, et al. A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis. PLoS ONE, 2015. 10(1): p. e0116385 [PMID:25635681] Hieno A, et al. Possible Involvement of MYB44-Mediated Stomatal Regulation in Systemic Resistance Induced by Penicillium simplicissimum GP17-2 in Arabidopsis. Microbes Environ., 2016. 31(2): p. 154-9 [PMID:27301421] Zhao Q, et al. AtMYB44 Positively Regulates the Enhanced Elongation of Primary Roots Induced by N-3-Oxo-Hexanoyl-Homoserine Lactone in Arabidopsis thaliana. Mol. Plant Microbe Interact., 2016. 29(10): p. 774-785 [PMID:27604593] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Nguyen NH,Cheong JJ H2A.Z-containing nucleosomes are evicted to activate AtMYB44 transcription in response to salt stress. Biochem. Biophys. Res. Commun., 2018. 499(4): p. 1039-1043 [PMID:29649476] Nguyen NH,Cheong JJ AtMYB44 interacts with TOPLESS-RELATED corepressors to suppress protein phosphatase 2C gene transcription. Biochem. Biophys. Res. Commun., 2018. 507(1-4): p. 437-442 [PMID:30448055]