PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 9264 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 64aa MW: 7769.01 Da PI: 11.662 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 46.3 | 9.6e-15 | 14 | 58 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r +WT E++++++a +++ + Wk+I ++g +Rt+ q++s+ qk+ 9264 14 RAPWTRIEHDKFLRALELYDRD-WKRIETHVG-TRTAAQIRSHAQKH 58 569*****************77.*********.************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 1.94E-16 | 9 | 61 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.61 | 9 | 63 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-9 | 10 | 63 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 9.4E-16 | 12 | 61 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 2.8E-11 | 13 | 61 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-12 | 14 | 58 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.92E-8 | 16 | 59 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 64 aa Download sequence Send to blast |
SKKPRKPYVR TKTRAPWTRI EHDKFLRALE LYDRDWKRIE THVGTRTAAQ IRSHAQKHFL 60 KSVK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator of evening element (EE)-containing clock-controlled genes. Forms a negative feedback loop with APRR5. Regulates the pattern of histone H3 acetylation of the TOC1 promoter. {ECO:0000269|PubMed:21205033, ECO:0000269|PubMed:21474993, ECO:0000269|PubMed:21483796, ECO:0000269|PubMed:23638299}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. Peak of expression in the afternoon. Down-regulated by cold. {ECO:0000269|PubMed:21205033, ECO:0000269|PubMed:22902701, ECO:0000269|PubMed:23638299}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP000598 | 1e-103 | CP000598.1 Ostreococcus lucimarinus CCE9901 chromosome 18, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_001422340.1 | 5e-40 | predicted protein, partial | ||||
Swissprot | Q8RWU3 | 5e-23 | RVE8_ARATH; Protein REVEILLE 8 | ||||
TrEMBL | A4SA87 | 1e-38 | A4SA87_OSTLU; Uncharacterized protein (Fragment) | ||||
STRING | ABP00657 | 2e-39 | (Ostreococcus 'lucimarinus') |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP454 | 14 | 27 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G09600.2 | 2e-25 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 9264 |
Publications ? help Back to Top | |||
---|---|---|---|
|