![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 42308 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
|
||||||||
Family | CPP | ||||||||
Protein Properties | Length: 151aa MW: 16482.5 Da PI: 8.4509 | ||||||||
Description | CPP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCR | 49.3 | 9.8e-16 | 29 | 68 | 2 | 42 |
TCR 2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 ++k+CnCk+skClk+YCeCfa+gk+C+ C+C +CkN++e+ 42308 29 QRKRCNCKNSKCLKLYCECFASGKYCDA-CNCAGCKNNDEH 68 689************************9.********9986 PP | |||||||
2 | TCR | 49.1 | 1.2e-15 | 114 | 151 | 1 | 38 |
TCR 1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkN 38 ++++gC+Ck+s ClkkYCeCf+a +C e+C+C +CkN 42308 114 RHNRGCHCKRSGCLKKYCECFQAAIYCVERCRCAECKN 151 5899*********************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01114 | 1.7E-15 | 28 | 68 | IPR033467 | Tesmin/TSO1-like CXC domain |
PROSITE profile | PS51634 | 33.678 | 29 | 151 | IPR005172 | CRC domain |
Pfam | PF03638 | 5.9E-12 | 31 | 65 | IPR005172 | CRC domain |
SMART | SM01114 | 3.4E-10 | 114 | 151 | IPR033467 | Tesmin/TSO1-like CXC domain |
Pfam | PF03638 | 3.5E-12 | 117 | 151 | IPR005172 | CRC domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 151 aa Download sequence Send to blast |
MRAGDDAIAS ASPRSIAARA STPRDSASQR KRCNCKNSKC LKLYCECFAS GKYCDACNCA 60 GCKNNDEHAH ERQSAIEQTL ERNPNAFRPK IINQTTNGTL DGAGAGDGAT TEARHNRGCH 120 CKRSGCLKKY CECFQAAIYC VERCRCAECK N |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5fd3_A | 3e-30 | 25 | 151 | 5 | 120 | Protein lin-54 homolog |
5fd3_B | 3e-30 | 25 | 151 | 5 | 120 | Protein lin-54 homolog |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in development of both male and female reproductive tissues. {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00269 | DAP | Transfer from AT2G20110 | Download |
![]() |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP000599 | 0.0 | CP000599.1 Ostreococcus lucimarinus CCE9901 chromosome 19, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_001422401.1 | 1e-106 | predicted protein, partial | ||||
Swissprot | Q9SL70 | 4e-49 | TCX6_ARATH; Protein tesmin/TSO1-like CXC 6 | ||||
TrEMBL | A4SAJ7 | 1e-104 | A4SAJ7_OSTLU; Uncharacterized protein (Fragment) | ||||
STRING | ABP00718 | 1e-105 | (Ostreococcus 'lucimarinus') |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP323 | 15 | 30 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G20110.1 | 9e-45 | Tesmin/TSO1-like CXC domain-containing protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 42308 |