PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf07242g05005.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 80aa MW: 9128.61 Da PI: 10.7381 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 94.1 | 6.3e-30 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 k+ien++nrqvtfskRrng++KKA+ELSvLCd++va+i+fs++g++ ++s Niben101Scf07242g05005.1 9 KKIENTTNRQVTFSKRRNGLIKKAYELSVLCDVDVALIMFSPSGRVSTFS 58 78***********************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.857 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.5E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.92E-37 | 2 | 75 | No hit | No description |
SuperFamily | SSF55455 | 1.15E-31 | 2 | 78 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.0E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.9E-28 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.0E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.0E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 80 aa Download sequence Send to blast |
MGRVKLQIKK IENTTNRQVT FSKRRNGLIK KAYELSVLCD VDVALIMFSP SGRVSTFSGN 60 KSIEDIMARY VNLPEHDRGR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 4e-19 | 1 | 80 | 1 | 79 | MEF2 CHIMERA |
6byy_B | 4e-19 | 1 | 80 | 1 | 79 | MEF2 CHIMERA |
6byy_C | 4e-19 | 1 | 80 | 1 | 79 | MEF2 CHIMERA |
6byy_D | 4e-19 | 1 | 80 | 1 | 79 | MEF2 CHIMERA |
6bz1_A | 4e-19 | 1 | 80 | 1 | 79 | MEF2 CHIMERA |
6bz1_B | 4e-19 | 1 | 80 | 1 | 79 | MEF2 CHIMERA |
6bz1_C | 4e-19 | 1 | 80 | 1 | 79 | MEF2 CHIMERA |
6bz1_D | 4e-19 | 1 | 80 | 1 | 79 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012851548.1 | 6e-50 | PREDICTED: MADS-box protein GGM13-like | ||||
Refseq | XP_015158292.1 | 1e-49 | PREDICTED: agamous-like MADS-box protein AGL104 | ||||
Refseq | XP_016568821.1 | 2e-49 | PREDICTED: agamous-like MADS-box protein AGL104 isoform X2 | ||||
Swissprot | Q9LM46 | 8e-38 | AG104_ARATH; Agamous-like MADS-box protein AGL104 | ||||
TrEMBL | A0A022QCZ8 | 6e-49 | A0A022QCZ8_ERYGU; Uncharacterized protein | ||||
TrEMBL | A0A1U8GBX3 | 4e-48 | A0A1U8GBX3_CAPAN; agamous-like MADS-box protein AGL104 isoform X2 | ||||
TrEMBL | A0A2G2X1P3 | 3e-48 | A0A2G2X1P3_CAPBA; Uncharacterized protein | ||||
STRING | Solyc04g078300.2.1 | 8e-49 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA6183 | 19 | 25 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G22130.1 | 3e-40 | AGAMOUS-like 104 |
Publications ? help Back to Top | |||
---|---|---|---|
|