PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g012020.1
Common NameMTR_1g012020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family CPP
Protein Properties Length: 868aa    MW: 93893.2 Da    PI: 5.796
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g012020.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.39.4e-16498534440
              TCR   4 kgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      k+CnCkkskClk+YC+Cf ag +C++ C Ce+C N+ 
  Medtr1g012020.1 498 KTCNCKKSKCLKLYCDCFGAGIFCGDGCACEGCGNRV 534
                      79*********************************86 PP

2TCR48.61.6e-15583622140
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      ++k+gCnCk+skC kkYCeCf+a++ Cs  C+C++C+N  
  Medtr1g012020.1 583 RHKRGCNCKRSKCTKKYCECFQANVGCSTGCRCDGCMNAF 622
                      589***********************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011149.2E-14495536IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163432.868496623IPR005172CRC domain
PfamPF036382.2E-12498533IPR005172CRC domain
SMARTSM011144.1E-15583624IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.2E-11585621IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 868 aa     Download sequence    Send to blast
MDSPEASKIN NISSSLSTIN AATNNPSDES PQVQESPFLR FVNTLSPIKP VKASHATHGF  60
LGLNSPPLVF KSPRISAPHR ETQYSERLEG THLSDTETSQ SNIGDNSLGE AHSDLKKLNS  120
QLPLPEVFIP VAQKDFDLKN DANTQSSSPP ASVDEYLADP VDDQMYPVNP EMEQSTDAVG  180
SSSLTESEKV ILKFDRSDGP SNIAEELLPL LEESNMVHQE RTEYVENPAT IEGEKNGAEL  240
VSQEHINLGS SSGADVFDKQ YCHDSLPQCT GNDQRHHSDC APQLMPDPIQ VVKEVENCSE  300
MVSTSQVNSE NIPQDGSEAS LKYHGIRRRC LQFGEAASVV LGSNKSHVKL NTTSSNAKMV  360
SVTVSKPPGI GLHLNSIINA MPPSCASTTG VRLSDGLPGS KSSISLHIVE NATRSSTPSN  420
MDGQSFIDTR NESNETDASV VADSFISESP ILTESIDLYP ANAPDKRRVS PTDAEEFNHP  480
STSRKKKKTS TDDASGPKTC NCKKSKCLKL YCDCFGAGIF CGDGCACEGC GNRVEFQDKV  540
VETKQQIESR NPQAFAPKIV PCAADVPPNN MEDVNMTTPA SARHKRGCNC KRSKCTKKYC  600
ECFQANVGCS TGCRCDGCMN AFGKREDFVA MEHASSNERE SSIVEEGLDD KLHKRQKIVT  660
IRTDLLRPAN HLSPVTPLLQ CSDQGKQGAK SRHSSTNLTK SSKKPRSSLA HSESNDSQKN  720
APPTHSSSTE NEWIDLPPYQ LSNRCGIRQL SGGSLRWRGS SPITPSADLD DESDGKLFDI  780
LEDETPDVLK EASTPIKSVK ANSPIRKRVS PPQSHLLRIG SSSSGGLKSG RKFILQSVPS  840
FPPLTPCADS KVLNDNEDSG NSTDKVT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A8e-174916204120Protein lin-54 homolog
5fd3_B8e-174916204120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1465487KRRVSPTDAEEFNHPSTSRKKKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr1g012020.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4555171e-178DQ455517.1 Medicago truncatula cDNA-AFLP fragment BT42M33_467 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024631077.10.0CRC domain-containing protein TSO1 isoform X3
TrEMBLG7I6F10.0G7I6F1_MEDTR; Cysteine-rich polycomb-like protein
STRINGAES589760.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85652841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.11e-54Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]