PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.L01321.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family MYB
Protein Properties Length: 110aa    MW: 12970.8 Da    PI: 9.7315
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.L01321.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.31e-142771348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +W++eEd++l + ++ +G+++W+ Ia+ +   +t  qc+ rw++yl
  Migut.L01321.1.p 27 SWSQEEDDILREQIRVHGTENWAIIASNFK-DKTTRQCRRRWFTYL 71
                      6****************************9.*************97 PP

2Myb_DNA-binding27.66.7e-0977105130
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIart 30 
                       +g W++eEd ll +a k +G++ W+ Ia+ 
  Migut.L01321.1.p  77 KGGWSPEEDMLLCEAQKIFGNR-WTEIAKV 105
                       688*******************.*****96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.3542075IPR017930Myb domain
SMARTSM007171.6E-122473IPR001005SANT/Myb domain
CDDcd001673.88E-112771No hitNo description
PfamPF139215.0E-162888No hitNo description
Gene3DG3DSA:1.10.10.601.3E-212883IPR009057Homeodomain-like
SuperFamilySSF466895.24E-2228102IPR009057Homeodomain-like
SMARTSM00717276109IPR001005SANT/Myb domain
PROSITE profilePS5129412.03376109IPR017930Myb domain
CDDcd001673.99E-480105No hitNo description
Gene3DG3DSA:1.10.10.601.5E-884108IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
MMKKKVINTT DLINGEVPKQ KERHIVSWSQ EEDDILREQI RVHGTENWAI IASNFKDKTT  60
RQCRRRWFTY LNSDFKKGGW SPEEDMLLCE AQKIFGNRWT EIAKVSQAR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-2227109991B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to DNA in promoters cis-regulatory element 5'-GGCGCGC-3' of cell cycle genes, including cyclins, cyclin-dependent kinases (CDKs), and components of the pre-replication complex (PubMed:20675570, PubMed:24687979). Binds to DNA in promoters cis-regulatory element 5'-AGCCG-3' of auxin regulated genes (e.g. PIN3 and PIN7) (PubMed:26578169). Together with FAMA and MYB88, ensures that stomata contain just two guard cells (GCs) by enforcing a single symmetric precursor cell division before stomatal maturity (PubMed:24571519). Represses the expression of the mitosis-inducing factors CDKB1-1 and CDKA-1, specifically required for the last guard mother cells (GMC) symmetric divisions in the stomatal pathway (PubMed:20675570, PubMed:24687979). Represses CYCA2-3 in newly formed guard cells (PubMed:21772250). Together with MYB88, regulates stomata spacing by restricting divisions late in the stomatal cell lineage thus limiting the number of GMC divisions (PubMed:11536724, PubMed:9684356, PubMed:16155180, PubMed:24123248). In collaboration with CDKB1-1 and CDKB1-2, restrict the G1/S transition and chloroplast and nuclear number during stomatal formation, and normally maintain fate and developmental progression throughout the stomatal cell lineage (PubMed:24123248). Also involved in the shape regulation of pavement cells (PubMed:9684356). Involved in sensing and/or transducing abiotic stress (e.g. drought and salt), probably via the positive regulation of NAC019 (PubMed:21105921). Regulates female reproduction being required for entry into megasporogenesis, probably via the regulation of cell cycle genes (PubMed:22915737). Promotes histone H3K27me3 marks and represses stem cell gene expression (PubMed:24654956). Required for lateral roots (LRs) initiation via the regulation of PIN3 expression in an auxin-dependent manner (PubMed:26578065). Involved in responses to gravity stimulation in primary roots by regulating the transcription of PIN3 and PIN7 in gravity-sensing cells, thus modulating auxin asymmetric redistribution (PubMed:26578169). {ECO:0000269|PubMed:11536724, ECO:0000269|PubMed:16155180, ECO:0000269|PubMed:20675570, ECO:0000269|PubMed:21105921, ECO:0000269|PubMed:21772250, ECO:0000269|PubMed:22915737, ECO:0000269|PubMed:24123248, ECO:0000269|PubMed:24571519, ECO:0000269|PubMed:24654956, ECO:0000269|PubMed:24687979, ECO:0000269|PubMed:26578065, ECO:0000269|PubMed:26578169, ECO:0000269|PubMed:9684356}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.L01321.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Strongly induced by auxin in a IAA14/SLR1 and ARF7 dependent manner, especially in xylem pole pericycle cells, lateral roots initiating cells. {ECO:0000269|PubMed:26578065}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012847460.11e-75PREDICTED: myb-related protein B
SwissprotQ94FL65e-53MY124_ARATH; Transcription factor MYB124
TrEMBLA0A059PSV27e-62A0A059PSV2_SALMI; MYB-related transcription factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41242134
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14350.22e-55MYB family protein
Publications ? help Back to Top
  1. Yang M,Sack FD
    The too many mouths and four lips mutations affect stomatal production in Arabidopsis.
    Plant Cell, 1995. 7(12): p. 2227-39
    [PMID:11536724]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Yang K, et al.
    Requirement for A-type cyclin-dependent kinase and cyclins for the terminal division in the stomatal lineage of Arabidopsis.
    J. Exp. Bot., 2014. 65(9): p. 2449-61
    [PMID:24687979]
  5. Yang M
    The FOUR LIPS (FLP) and MYB88 genes conditionally suppress the production of nonstomatal epidermal cells in Arabidopsis cotyledons.
    Am. J. Bot., 2016. 103(9): p. 1559-66
    [PMID:27620181]
  6. Xie Y, et al.
    An atypical R2R3 MYB transcription factor increases cold hardiness by CBF-dependent and CBF-independent pathways in apple.
    New Phytol., 2018. 218(1): p. 201-218
    [PMID:29266327]