PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Manes.08G004700.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 90aa MW: 9991.73 Da PI: 10.04 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 136 | 9e-43 | 22 | 89 | 3 | 70 |
S1FA 3 vakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 v veakG+nPGlivllvvggl+l+fl+gny+ly yaqk+lPP+kkkPvskkk+kre+lkqG+++PGe Manes.08G004700.1.p 22 VDDVEAKGFNPGLIVLLVVGGLVLTFLIGNYVLYLYAQKTLPPKKKKPVSKKKMKRERLKQGISAPGE 89 5689***************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD019013 | 1.0E-4 | 22 | 89 | No hit | No description |
Pfam | PF04689 | 1.8E-40 | 25 | 89 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 90 aa Download sequence Send to blast |
MEDDFEFADH SPPSFQNMRN VVDDVEAKGF NPGLIVLLVV GGLVLTFLIG NYVLYLYAQK 60 TLPPKKKKPV SKKKMKRERL KQGISAPGE* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Manes.08G004700.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021620311.1 | 4e-59 | DNA-binding protein S1FA-like | ||||
Swissprot | Q42337 | 1e-16 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
TrEMBL | A0A2C9VCE6 | 9e-58 | A0A2C9VCE6_MANES; Uncharacterized protein | ||||
STRING | cassava4.1_020251m | 1e-58 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5409 | 33 | 55 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Manes.08G004700.1.p |