![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Manes.03G063600.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 92aa MW: 10024.8 Da PI: 10.1892 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 131.8 | 1.7e-41 | 24 | 91 | 3 | 70 |
S1FA 3 vakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 v+ +eakG+nPGlivll+vggl+l+fl+gny+lyvyaqk+lPP+kkkP+skkk+kre+lk Gv++PGe Manes.03G063600.1.p 24 VKDIEAKGFNPGLIVLLLVGGLVLTFLIGNYALYVYAQKTLPPKKKKPISKKKMKRERLKHGVSAPGE 91 6789***************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD019013 | 7.0E-7 | 24 | 91 | No hit | No description |
Pfam | PF04689 | 8.6E-40 | 27 | 91 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 92 aa Download sequence Send to blast |
MDVEDGFEFA DHSPPSFQNV GNVVKDIEAK GFNPGLIVLL LVGGLVLTFL IGNYALYVYA 60 QKTLPPKKKK PISKKKMKRE RLKHGVSAPG E* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Manes.03G063600.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021607403.1 | 4e-60 | DNA-binding protein S1FA-like | ||||
Swissprot | Q7XLX6 | 8e-15 | S1FA2_ORYSJ; DNA-binding protein S1FA2 | ||||
TrEMBL | A0A2C9W517 | 8e-59 | A0A2C9W517_MANES; Uncharacterized protein | ||||
STRING | XP_002525167.1 | 2e-36 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5409 | 33 | 55 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37120.1 | 4e-06 | S1FA-like DNA-binding protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Manes.03G063600.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|