![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10015073 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 90aa MW: 9837.6 Da PI: 10.4765 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 132 | 1.6e-41 | 23 | 89 | 4 | 70 |
S1FA 4 akveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 + +eakG+nPGlivllv+g+l+l fl+gny+ly+yaqk+lP rkkkPvskkk+kre+lkqGv++PGe Lus10015073 23 KDAEAKGFNPGLIVLLVIGTLVLAFLIGNYALYMYAQKTLPARKKKPVSKKKMKRERLKQGVSAPGE 89 679***************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD019013 | 5.0E-7 | 21 | 89 | No hit | No description |
Pfam | PF04689 | 2.1E-40 | 25 | 89 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 90 aa Download sequence Send to blast |
MSDDSEFADQ STPSFERMGK AMKDAEAKGF NPGLIVLLVI GTLVLAFLIG NYALYMYAQK 60 TLPARKKKPV SKKKMKRERL KQGVSAPGE* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10015073 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU829584 | 1e-147 | EU829584.1 Linum usitatissimum clone LU0015D12 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002525167.1 | 4e-33 | DNA-binding protein S1FA | ||||
Swissprot | P42553 | 1e-16 | S1FA1_ORYSJ; DNA-binding protein S1FA1 | ||||
TrEMBL | B9SGP8 | 9e-32 | B9SGP8_RICCO; DNA-binding protein S1FA, putative | ||||
STRING | Lus10015073 | 1e-58 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5409 | 33 | 55 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37120.1 | 3e-09 | S1FA-like DNA-binding protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10015073 |