PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR12G15290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family CPP
Protein Properties Length: 729aa    MW: 78322 Da    PI: 6.9176
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR12G15290.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.67.6e-16454493241
              TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                      ++k+C+CkkskClk+YCeCf+ag++Cs+ C+C++C Nk +
  LPERR12G15290.1 454 SCKHCSCKKSKCLKLYCECFHAGVFCSDPCSCQGCLNKPS 493
                      689**********************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.2E-16453494IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163417.706454546IPR005172CRC domain
PfamPF036386.2E-12456491IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 729 aa     Download sequence    Send to blast
MDTPDRAPRA ATAAAVEDSP VFNFINSLSP IPPPKPSDSA HNVQLFKSSD LAPVSSIFAS  60
PHVNPAKESK LLIRDDSVQL SQESHSPNSV RTRTGATSSI RMIRCKNIVS ENCSIACCLN  120
ESNSSKTSQS IQLCGGSAES DKNQNSDGKK DLTTEQDSTN LEFVLLDQNG PEKMDSLLLG  180
NIVSDNQLSE QQKDGLGSFD AVYMIAHQPN SDMLRLAPPF ESETQLVSET LETDDVYCES  240
LLNGGPSGSH IQNSAPDPHL YWAGAVEGSA TDYTPQMLPG ACQSQLVPND QISNKLNEPS  300
DYMPIDQNVS SQNLRGMRRR CLFNEKAGAS NKGVKNTPVR HSTNLTTPRR KTSSSDNKLK  360
ILRTPPCALP GIGLHLNALT AVPKEKAVIH NETQSSLNQA SNVLSAVGSS PPIADLHTVN  420
DDSSQATMVA YVDESSQGSP KKKRHKFDNG DGTSCKHCSC KKSKCLKLYC ECFHAGVFCS  480
DPCSCQGCLN KPSNMEAVLS IREQIESRNP LAFAPKVIRT EPGQELAGGV GCSVNCRCEG  540
CKNAFGRREV EGVTLLSIED AKRGCREKNE GMKEETIDND KQLVIYQDST NLTPAESVLT  600
TPSVADCRPL AALPPLSSKK PRSSTKLGGY SSRLEGPLKS DIVLSPFESY AEMMLGDGTS  660
NTLKGELSPQ NSVKVVSPNK KRVSPPRIGT GLSPICKSGR KLILKSIPSF PSLGGDITNE  720
NPNTSSLAP
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR12G15290.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0739420.0AK073942.1 Oryza sativa Japonica Group cDNA clone:J033075J10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620275.10.0protein tesmin/TSO1-like CXC 2
TrEMBLA0A0D9Y1880.0A0A0D9Y188_9ORYZ; Uncharacterized protein
STRINGLPERR12G15290.10.0(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP127462630
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.16e-47Tesmin/TSO1-like CXC domain-containing protein