![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kaladp0093s0098.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 145aa MW: 16803.3 Da PI: 8.0721 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 182.5 | 3e-56 | 1 | 143 | 230 | 373 |
GRAS 230 lvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerl 319 +vksl+Pkvv+++eqe+++n+++F++rfle+l+yysa+f+s+++++pr+s+eri+vE ++l+r+ vn++aceg+er+erhe l+kW++r+ Kaladp0093s0098.1.p 1 MVKSLNPKVVTLIEQESNTNTTPFFNRFLETLDYYSAMFESIDVTMPRDSKERINVEMHCLARDMVNIIACEGKERVERHELLGKWKSRF 90 69**************************************************************************************** PP GRAS 320 eeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373 ++aGF++ pls+++++ + +ll+ ++ + y++ee++g+++lgWk+r+Lvs+SaW Kaladp0093s0098.1.p 91 TMAGFRQFPLSTYVNSVIGSLLKCYS-EHYTLEERDGAMLLGWKRRNLVSASAW 143 **********************9988.66************************* PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03514 | 1.0E-53 | 1 | 143 | IPR005202 | Transcription factor GRAS |
PROSITE profile | PS50985 | 27.33 | 1 | 125 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 145 aa Download sequence Send to blast |
MVKSLNPKVV TLIEQESNTN TTPFFNRFLE TLDYYSAMFE SIDVTMPRDS KERINVEMHC 60 LARDMVNIIA CEGKERVERH ELLGKWKSRF TMAGFRQFPL STYVNSVIGS LLKCYSEHYT 120 LEERDGAMLL GWKRRNLVSA SAWH* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5hyz_A | 2e-23 | 1 | 144 | 228 | 375 | GRAS family transcription factor containing protein, expressed |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | May play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015898184.1 | 1e-89 | chitin-inducible gibberellin-responsive protein 1-like | ||||
Refseq | XP_028126224.1 | 4e-90 | chitin-inducible gibberellin-responsive protein 1-like | ||||
Swissprot | Q69VG1 | 8e-79 | CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1 | ||||
TrEMBL | A0A498K7Y7 | 5e-87 | A0A498K7Y7_MALDO; Uncharacterized protein | ||||
STRING | XP_008365835.1 | 8e-88 | (Malus domestica) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G48150.2 | 2e-75 | GRAS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kaladp0093s0098.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|