![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kaladp0068s0350.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 104aa MW: 11486.9 Da PI: 4.0194 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 40.4 | 8.2e-13 | 1 | 41 | 61 | 101 |
DUF260 61 lvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101 +vyeA+ar+rdPvyG++g i +lq+q+++l+ ela++++e+ Kaladp0068s0350.1.p 1 MVYEANARLRDPVYGCAGAICHLQRQVSELQGELAKAQAEI 41 69**********************************99875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03195 | 7.4E-11 | 1 | 38 | IPR004883 | Lateral organ boundaries, LOB |
PROSITE profile | PS50891 | 9.457 | 1 | 41 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 104 aa Download sequence Send to blast |
MVYEANARLR DPVYGCAGAI CHLQRQVSEL QGELAKAQAE IVAIQLQKSN LLTLICMDDQ 60 DQHMFSYGQC VDDTNQNVSF DELYGIGSFM DSSYANSLES LWA* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017246117.1 | 6e-30 | PREDICTED: LOB domain-containing protein 1-like | ||||
Swissprot | Q9LQR0 | 1e-24 | LBD1_ARATH; LOB domain-containing protein 1 | ||||
TrEMBL | A0A162A993 | 1e-28 | A0A162A993_DAUCS; Uncharacterized protein | ||||
STRING | AES67410 | 1e-28 | (Medicago truncatula) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G07900.1 | 4e-27 | LOB domain-containing protein 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kaladp0068s0350.1.p |