![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kaladp0039s0104.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 128aa MW: 14433.6 Da PI: 8.4802 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 130.1 | 9.3e-41 | 10 | 109 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 +Ca Ck+l+rkC++dC++apyfp ++p+kf n+hk+FGasnv+kll++lp+ +r+da++s++yeA ar+rdPv+G+v+ i +lq+q + l Kaladp0039s0104.1.p 10 PCACCKFLKRKCPPDCIFAPYFPPQDPHKFINIHKIFGASNVSKLLNELPPYQRSDAVKSMAYEAAARVRDPVHGCVAEICSLQRQAQLL 99 7***************************************************************************************** PP DUF260 91 kaelallkee 100 ++el++++++ Kaladp0039s0104.1.p 100 QKELEAANAR 109 ****998865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 26.153 | 9 | 110 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.0E-40 | 10 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 128 aa Download sequence Send to blast |
MASSSFFNSP CACCKFLKRK CPPDCIFAPY FPPQDPHKFI NIHKIFGASN VSKLLNELPP 60 YQRSDAVKSM AYEAAARVRD PVHGCVAEIC SLQRQAQLLQ KELEAANARL RNYETFNSYP 120 YSLPWND* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 8e-52 | 8 | 124 | 9 | 127 | LOB family transfactor Ramosa2.1 |
5ly0_B | 8e-52 | 8 | 124 | 9 | 127 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003525551.2 | 2e-56 | protein LATERAL ORGAN BOUNDARIES | ||||
Refseq | XP_006579579.1 | 2e-56 | protein LATERAL ORGAN BOUNDARIES | ||||
Refseq | XP_006579580.1 | 2e-56 | protein LATERAL ORGAN BOUNDARIES | ||||
Refseq | XP_006579581.1 | 2e-56 | protein LATERAL ORGAN BOUNDARIES | ||||
Refseq | XP_020213713.1 | 1e-56 | protein LATERAL ORGAN BOUNDARIES | ||||
Refseq | XP_028231547.1 | 2e-56 | protein LATERAL ORGAN BOUNDARIES-like | ||||
Refseq | XP_028231548.1 | 2e-56 | protein LATERAL ORGAN BOUNDARIES-like | ||||
Refseq | XP_029126746.1 | 1e-56 | protein LATERAL ORGAN BOUNDARIES | ||||
Refseq | XP_029126747.1 | 1e-56 | protein LATERAL ORGAN BOUNDARIES | ||||
Refseq | XP_029126748.1 | 1e-56 | protein LATERAL ORGAN BOUNDARIES | ||||
Swissprot | Q9FML4 | 5e-55 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A2G3C9T0 | 1e-55 | A0A2G3C9T0_CAPCH; LOB domain-containing protein 6 | ||||
STRING | GLYMA05G02530.4 | 7e-56 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 2e-57 | LBD family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kaladp0039s0104.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|